TDJ>8MDof#4L/F Technologies GEN-16TurboDOS-16 v1.43+16d.01(c) Software 2000 SN 4/10930: 16-BIT GEN & OLD SYS(FCH) 4% P    WcGEN-16 CKT12X O CKTDCB O CNFLOD O CNFTBL O CONREM O  CONSOL O  CPMSUP O  DW1100 O  FD930 O * LINK DO LST300 O LSTCNT O LSTCTS O NLSTETX O LSTIMS O LSTXON O MCD O MCD740 O MDISK O MEMTBL O MPMSUP O MST256 O NETFWD O NIT186 O OLDMASTRGEN) !"2OLDMASTRPAR#$%&'()*OLDMASTRPAR+,?OLDMASTRSYS-./01234OLDMASTRSYS56789:;<_3OLDMASTRSYSR=>?@ABOLDSINGLGENCDrOLDSINGLPARxEFGHIJKLOLDSINGLSYSMNOPQRSTOLDSINGLSYSiUVWXYZ[OLDSPOOLGEN\]pOLDSPOOLPAR^_`abcdeOLDSPOOLSYSfghijklmOLDSPOOLSYS{nopqrstuOSBOOT O vPATCH 001wPATCH O xQIC02 O yQUEMGR O zRESSLV O {RTC O |zRTC1081 O }RTC186 O ~RTCNUL O SCD186 O SLV1081 GENSLV1081 PAR4SLV1240 GENPSLV1240 PARdSLVMDSK O hSLVRES O SPB124 O SPB127 O SPB186 O SPB740 O SPD186 O STDLOADRGEN!5STDLOADRO STDLOADRO #STDLOADRPARSTDMASTRGEN)STDMASTRO STDMASTRO STDMASTRO jSTDMASTRPARSTDMASTRPARSTDSINGLGENSTDSINGLO STDSINGLO xSTDSINGLPARpSTDSLV86O STDSLV86O JSTDSPOOLGENȟTSTDSPOOLO STDSPOOLO STDSPOOLO 2STDSPOOLPARw     SUBMIT O TDOSLDR O TPCSUP O USRFCN O USRSOM O USRSUP O XS3040 O XTACE O XTISR O XTS1250 O XTSCC O XTSER O   *  &IW0CKT12X>DataSST12XTYP12X  (ڊ莨    vCKTDCBDataCKTDCBCKTUC0 CKTUC1CKTUC2CKTUC3$CKTUC4-CKTUC56CKTUC6?CKTUC7HCKTUC8QCKTUC9ZCKTUCAcCKTUCBlCKTUCCuCKTUCD~CKTUCECKTUCFCKTUCGCKTUCHCKTUCICKTUCJCKTUCKCKTUCLCKTUCMCKTUCNCKTUCOCKTUCPCKTUCQCKTUCRCKTUCSCKTUCTCKTUCU              1                      !2CONFIGCodeXLUTPF5PF8PWORDPAC820PAC8E0UF80 UF81 UF82 UF83 UF50 UF51UF52UF53UW0UW1UW2UW3DSKDRADSKDRBUndDataNMBSVCNMB740NMBMBSNMBRPSNMBUFSDSKASTLSTDRALSTDRBLSTDRC LSTDRD!PRTMOD"QUEPTR#SPLDRV$EOPCHR%DSPPAT&PTRAST'QUEAST(AUTUSR)LOGUSR*CLBLEN+CLSCHR,CLPCHR-SRHDRV+.ATNCHR/ATNBEL0RESCHR1ABTCHR2ECOCHR3PRTCHR4COMPAT5BFLDLY6MEMRES7SLVFN8CPMVER9SUBFN:LOADFN;SCANDN<CONBR=PAT740>SST740?JDATE@USRSOMACTSBRBXONBRCETXBRDETXLENEETXSEQFCTSFFGETXFFHXONFFIIMSFFJPBASEKCSWTCHLTYPSLVMSRT401NSRT431OCONASTPLDCOLDQLDWARMRWARMFNSCOLDFNTBUFSIZUMEMBLLVMEMTOPWDEFDIDXCURBNKYFWDTB LZCKTAST[NMB12X\TYP12X]SST12X^NMBSER_SERIAL`SDCB0aSDCB1bSDCB2cSDCB3dSDCB4eSDCB5fSDCB6gSDCB7hSDCB8iSDCB9jDSPINPkRAMBULlOSMLENmOSMTOPnBUFBASoBUFLENpTRKBUFCNFLOD!U``````` ` ` ` ` ``````````````````` `!`"`#`$`%`&`'`(`)`*`+`,`-` 8  1g.`/`0`1`2`3``4`5`6`7`8`9`:`;`<`=`>`?`@`A`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[`\`]`^`_`[``a`b`c`d`e`f`g`h`i`j`k`l`m`n`o`p`@ CONFIGCodeXLUTPF5PF8PWORDPAC820PAC8E0UF80 UF81 UF82 UF83 UF50 UF51UF52UF53UW0UW1UW2UW3DSKDRADSKDRBUndDataNMBSVCNMB740NMBMBSNMBRPSNMBUFSDSKASTLSTDRALSTDRBLSTDRC LSTDRD!PRTMOD"QUEPTR#SPLDRV$EOPCHR%DSPPAT&PTRAST'QUEAST(AUTUSR)LOGUSR*CLBLEN+CLSCHR,CLPCHR-SRHDRV+.ATNCHR/ATNBEL0RESCHR1ABTCHR2ECOCHR3PRTCHR4COMPAT5BFLDLY6MEMRES7SLVFN8CPMVER9SUBFN:LOADFN;SCANDN<CONBR=PAT740>SST740?JDATE@USRSOMACTSBRBXONBRCETXBRDETXLENEETXSEQFCTSFFGETXFFHXONFFIIMSFFJPBASEKCSWTCHLTYPSLVMSRT401NSRT431OCONASTPLDCOLDQLDWARMRWARMFNSCOLDFNTBUFSIZUMEMBLLVMEMTOPWDEFDIDXCURBNKYFWDTBLZCKTAST[NMB12X\TYP12X]SST12X^NMBSER_SERIAL`SDCB0aSDCB1bSDCB2cSDCB3dSDCB4eSDCB5fSDCB6gSDCB7hSDCB8iSDCB9jDSPINPkRAMBULlOSMLENmOSMTOPnBUFBASoBUFLENpTRKBUFqCKT12XrNMBCKTsLFLST1tLFLST2uSDCBAvSDCBBwSDCBCxSDCBDySDCBEzSDCBF{EndCode|EndData}CKTDCBCNFTBL!U``````` ` ` ` ` ``````````````````` `!`"`#`$`%`&`'`(`)`*`+`,`-`.`/`0`1`2`3``4`5`6`7`8`9`:`;`<`=`>`?`@`A`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[`\`]`^`_```a`b`c`d`e`f`g`h`i`j`k`l`m`n`o`p`q`r`s`t`'=3u`v`w`x`y`z`{`|`}`    CONREMOriginBUnitDatabCodeALLOCATNCHRSIGNALLDIRDMSWAIT LNKPOL UNLINKCIBSZRCDNITRCFCNCONDR_$@` a a!`N````DgtDOÊDUtR`8u``` ``B9r.``Cڋ`K`9s```t` DV:t Tjll` ` a DOÈЄt< t]t'ty,t?t 0`t` u```Cڋ`K`9s``À>` t>` s` C` `  uQ` `Yà` <s ` `(CONSOLDataWCodeSERIALDMSCONBRFFCHRCONDR_ `u #<u<u ,t*t&`RQ`` t YQYZ 0NMBMBSNMBRPSNMBUFSDSKASTLSTDRALSTDRBLSTDRC LSTDRD!PRTMOD"QUEPTR#SPLDRV$EOPCHR%DSPPAT&PTRAST'QUEAST(AUTUSR)LOGUSR*CLBLEN+CLSCHR,CLPCHR-SRHDRV CPMSUPOriginBUnitDataCodeXTNTRYIOBYTERIBFCNSIBFCNRLIFCN2WPDFCN@RROFCN`DPBFCNRDFCNRSNFCN`DOÊDU`ú  RS[utZy\OÊTiDOú  RS[tZy\OÊTi xڻ`\O\_QSTiK[$PG0ug̀ẗgWʶXuJW uW G XG Ë\U s RS [ZyË\UD] &C   DW1100CodeDMXSPHWAITSIGNALDataDSKDR_WDCISR[DSKIN_ VW؎` P`X_^Ê<t.<t0<t2<t9<tD<u <t?<tA<tC<tC<tEð Cð =  <t\ÊD  <tð ð ð  ð ð PD G `X1ۈ>`` >`u`t =```` %` `DDD P&` XD s``D``D``DD P&` XD s``D``` DDDDDD ` DÊ`0V6`` >`u^`u`PSQ xB tKuY[X` Y[XJ`SQ xB u Ku`Y[JË` >`u!` >`u``u``` ` 0 0 WtP`D D ؉D `D `D` `>`r``*` >` X`B$uJJBt@J >`u+ >`u` >`u``u ``0`BQ Y0` ` `Ȣ` ouE``t` ``ϡ`+``>`u= r= r``` 0```GDuF t>VYÍ `6`>` V؎T:`v ` Ӌ?U׹  ߉֊<r <uVWL `\ D ؉_^`D D =Fu$dDDt(r([SD DGDE tP\;] rH];\s\D] E ׈D u0Lt-[S\ ML E <u <@r,@ t^VƊ<s&<uPWV| LD `ؾ ^_X <r`RZ^6`>` È uK=Fu@VuD `\ `:D t u^ \ ] \ ] LEV[]^]\Ј ^؋\ \ 0 ]mVW>V_^ !p aIOSUB&CodeSIGNALWAITDataXFLAGSXFLAGWdisavsisav US>`6`6`>`[]!XDF   9300CodeXFLAGWXFLAGSDataXDF6XSF+CONTBLXIF1<r & >Fu ?t P X0`GG>f6`$>~+  Gu CN1G>V 4S9[ u!>V$ t ? zt 7G >F)G >F'GG:Gr*GG @G GG# u   ~t 0t G >F)G >F'gGG:Gr*G G@G EGP)vYOG 2 O GG  YO#?t G u,G u& |u$Gt {uGt Gt e1  Gt Gu t  uG@t F u f O 0 ggPuG G t tÀOO lÀuGPG*  `t< utG( DG@t C uGt G tgÀgߊG$K F'G >F) j0g wGtGG$$:t FGGG0ËO:Os0GtG GtoGt t  . t  G@*G ÊG$ Àg>F >F >:F rYG V>FGر G>FG>F>F/ J 3ô@>~->~- >~-g GGG G$GGu >F/ S^[>F$t>F u>F  u >F  u X@ uLG>~- dG$GGG ->N  >F/ S^[>f g>F$tËG#H>V G>F)P>f&X>F's>F&>V>F&>V>VB>~-G>F/ S^[G>F$< t>~- G>F/ S^[>F$< t ;t t- )G$> F%G =tO>F"0:GG u0>~- 6>F/ zS^[>F$>~- >F/ Y>F2 t>FGt @G GñG>N  >F >f >F >V>V>V>v-0 >N/Q + uYY [>V>~00>N2Q &uYY < 0J P쨀uXBX0 J uB0Q Yð> VtK >V$V u uш$f>F >F2 Ru^q$^.$961+M$`M$`M$`     `P`(`(`    @ A$B(CI 2J Hj HK*P &:G: 6 ( 5tXLF58DataUF80PF8UF81UF82UF83UF50PF5 UF51 UF52R UF53XLUTLDKLENXLUTg$6HZl~F80 ``$F81 ``$F82 ``$F83 ``$F50 ``$F51 ``$F52 ``$F53 ``$XUF58(DataUF50UFC50%UF517UFC51JUF52\UFC52oUF53UFC53UF80UFC80UF81UFC81UF82UFC82UF83UFC83%  !%  !%  !%  !%  !%  !%  !%  !XPF58vDataXSFXDF#CodeXIFPF8CPF5FDCISR b```  5!a`' b==;```  !aRY`b  ý`>Ftý`C>FtDSTTBLDataDSTTBLDSTEL # (O # P_ #(K #(J # (j #PN # Pn "(`I " (`M " P`] >#^ e# ~ h#M 4#M  4#M #M #M  =# "4M`[   ["M`A  "M`'           $- &/ (1!*3#, %. '0 )2"+          pTRKBUFqCKT12XrNMBCKTsLFLST1tLFLST2uSDCBAvSDCBBwSDCBCxSDCBDySDCBEzSDCBF{EndCode|EndData}CKTDCBCNFTBL!U``````` ` ` ` ` ```   |0:tlink stdloadr.cmd copy stdloadr.cmd 0: ;n copy stdloadr.cmd 0:osload.cmd ;n delete stdloadr.cmd 0:tlink stdsingl.sys copy stdsingl.sys 0: ;n copy stdsingl.sys 0:osmaster.sys ;n delete stdsingl.sys 0:tlink stdspool.sys copy stdspool.sys 0: ;n delete stdspool.sys 0:tlink stdmastr.sys copy stdmastr.sys 0: ;n delete stdmastr.sys 0:tlink oldmastr.sys 0:tlink oldspool.sys 0:tlink oldsingl.sys 0:tlink slv1081.sys copy slv1081.sys 0: ;n delete slv1081.sys 0:tlink slv1240.sys copy slv1240.sys' 0: ;n delete slv1240.sys 2LST300Data2CodeSERIALLST3BRLST3FFLSTDR_% `ÊuRQ`YZ<t <tÊ` STATUS     YLSTCNTCodeLNKPOLWAITUNLINKSIGNALDataLSTDR_PBASE0PBASE1CNTFFt>`t(`R`0>`t`R`0@Zt tÊ`t3``  `` Ut F` S` ``` `` "t ` ``J0B0$<B@ a !`[ a!`    LSTCTSData2CodeSERIALCTSBRCTSFFLSTDR_n `ÊuRQ`YZ<t <tÊ`NG STATUS *%  !XPF58vDataXSFXDF#CodeXIFPF8CPF5FDCISR b```  5!a`' b==;```    bOLSTETX4DataCodeSERIALETXBRETXLENETXSEQETXFFLSTDR_ `$ uRQ`YZ<t <tÊ` Y:`r S uQ : .$,u 6 Y$<u -`  D  yQRQRZYû``PX^ b           n    YLSTIMSCodeLNKPOLWAITUNLINKSIGNALDataLSTDR_PPMODIMSFFPBASE`uR Ztt`` [ VÊ```  ` CШuà` 0 ) $` `  "ú  ú  ú  ú  Ê`0 a!`?;    LSTXONData^CodeSERIALXONBRXONFFLSTDR_ `ÊuRQ`YZ<t <tÊ` t $<u $<uQRQRZY` Ut F` S` ``` `` "t ` ``J0B0$<B@ a !`[ a!`               lMCDDataCKTDCB[CodeSST12XTYP12XADDRSTBLMASTERLNKPOL NMBCKT CKTAST WAIT TICCNT RESSLVDELAYSIGNALUNLINKSYSSEGpssisaversdisavetMSGSPHJPOLSLVBADINTCKT12XCKTNBRMYNODPOLTIMDCBSAVNMB12XNBRSLVCKTIN_(KB_RES,CKTDR_RCVR;GODSNDRBADSNDlREQSOBRELSOB709 Xd( avv a|| a!`J a VW>`j6`h1 `ȫ`ȫ  :  <؎>`t*`0Q`6` GY`6` G>`U>`uP .@t`tf0` GU U OU U$ ]`W>`j6`h_* `06 ` ؋ 8t `U$PUX U ( $$_^Q   YQ  YVW؎tu 7`&`_^À>`u-`t&`R:u` ` ZGOu R`t >`n6`l>`tJ`` `G`G 4` GuGS>`n6`l[Z E>`n6`lWV^_ Zփ>`RU$UUZ 8r v  A0 2O6` 0R؎UUWl_UU  ($ZÉ0>N` `G`GR` 6`p>`r Z0>N` >F% uGt O Gt`U쨀ud@t->`u `tP` VW6`p>`rS [_^ [ZXփUUnU@uU `G`G0 [ZX {O6`PR`ZX >` (@t U $ ( @U .@u! ($VW6`p>`rS`z [_^G$>`U Ë>`U U$ ($S` [6`p>`r o >`U쨀u1@tO %U )UU U@tO G S`[À>`u``Rڠ`8u`  `ZGt=Gt7Gu1 ` *G<`U$UU<uUU U UU ( `t " a`0&`2   p           X  MCD740DataCodeLNKPOLWAITSIGNALDID740SID740SSL740 DID186 SID186 SSL186 LAD740 LEN740LAD186LEN186UNLINKTICCNTNMB740CKT740PAT740SST740;"TYPSLVCKTIN_CKTDR_@DHLPTX\  v ahh!` att azz!```5 Ètu à`5}`BBBBڊڢ`4R`l I`f [u r>t Gr7S < r,t(`4 :rCIt r `2 r0â`5`2 `2 `2  Q''uÀ'`xCCCCCKu SP`rX`3 t  t @u ^^`r[ : [ `3 1' '' ? `ư  0@tS $[uÀ@'`"ӊtt$`dz`É``ӊ` $`dz. `. ``ӊ. `RBJJJBBB g aZ`"ӊtt `  sË ` (.` .C r.`.C rðJµR ZsQ Yà` u$`2 :s tuR tJJZ<u'Z sÀ`l`f RZ X-u sÀ`~`x RBZ -s<u<tÊC 4s0 sÈC0RQ  uYZYJJZRQ P쨀XuYZYJJZȶ`FӠ`S`FӠ`*[<<à`2`3¶`ӊ'Ļ`!6ȶ û`V0@ KMDISKCodeDataDSKDR_ RDBAS RDLEN>`t  w0`á`  t4`  t-```W ` 1 _``À>`t [W| V1^_À>`t 9W1Vt ^_À>`u ` DðÀ>`uððËTTL ` ‹Ld[}! "`J0B0$<B@ a !`[ a!`               [MEMTBLDataMEMTBLRAMBUL!@?USER DEFINED) RDDFCN == BYTE 42 ;FUNCTION 42 (REBUILD DISK MAP) ; WAIT TICCNT RESSLVDELAYSIGNALUNLINKSYSSEGpssisaversdisavetMSGSPHJPOLSLVBADINTCKT12XCKTNBRMYNODPOLTIMDCBSAVNMB12XNBRSLVCKTIN_(KB_RES,CKTDR_RCVR;GODSNDRBADSNDlREQSOBRELSOB709    MPMSUPOriginBUnitDataMQFCNOQFCNDQFCNURQFCNCRQFCNUWQFCNCWQFCNf Code DELAY CKTAST XTNTRYRCNOFFRCNMSK MPMFCN``````` a ; I/O driver for 1230 SCC ports only ; ; Set Two ; XTSER Y - ; Serial I/O handler: must be present XTSCC +; Serial driver for Model 1230 ports XTACE ?; Serial driver for Model 631 and 480 boards - "Asynchronous ; ; Communications Elements" ;&== ; !CONSOLE SELECTION - Choose one ;&== ; CONREM E ; Console emulator for use by MASTER program run from slave ;CONSOLg ?; Choose this module if you have a terminal on the master ; ;&== ; ; PRINTER SELECTION ; How many printers you can choose depends upon how many serial ports you ; have available. Which drivers you choose depends upon your printers. ; ;&== ; LSTETX ! ; ETX-ACK Serial Printer LSTIMS $ ; Centronics parallel printer driveqr ; ;&== ; NETWORKS ;&== ; ; The Circuit 0 slave boards are Models 740, 862, and 1081. The Circuit 1 ; slave boards are the S100+ bus slaves. ; ; If you have: then choose: ; ; A. Circuit 0 slaves ONLY The single module in SET ONE ; B. Circuit 1 slaves ONLY F All 5 modules in SET TWO ; C. Both Circuit 0 AND Circuit 1 slaves n Both SET ONE and SET TWO ; ;* SET ONE: This module services the Model 740, 862, and 1081 slaves ; MCD740 . ; Master Circuit Driver for Circuit 0 SPB740 6 ; Intermediate loader for 740/862 type slaves SPB186 o ; Intermediate loader for 1081 type slaves ; ;* SET TWO: These modules service the S100+ bus slaves ; MCD 0; Master Circuit Driver for Circuit 1 ; CKTDCB ( ; Circuit Device Control Blocks CKT12X 3 ; Slave Suffix Table & Type - patch points SPB127 T  3W_ ? ; Slave Intermediate Loader for S100+ bus 8-bit slaves SPB124 @ ; Slave Intermediate Loader for S100+ bus 16-bit slaves RESSLV > ; Routine to reset slave & download intermediate loader ; ;&== ; ; DISKS ; ;&== ; ; `DISKS ; ; LFT supports three standard configurations ; ; A. Floppies ; B. DMA winchesters (1100 controller). ; C. RAM disk ; ; Choose one of the sets below accordingly. ; ; NOTE: The order of the driver modules determines the name of the ; =driver entry point. For example, if you have Floppies and ; ; Search drive for command files = system disk JDATE = 0x3639 ' ; Cold-start date = Jan 01, 1986 ; ;&== ;  & PATCHES ;&== ; ; Patch 1.43-01 ; ; The following patch is applicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fcn 15 opening the ; files $.DIR or $.DSK when FCB byte 32 is FF. The ; 'PATCH' module must be included during system generation. ; OPNFIL + 0x4A = [PATCH] PATCH = 0xE8, [CKSPFN], 0xB0, 0x00, 0x74, 0x03, 0xE9, [OCECOM],  0x83, 0 )3%xC4, 0x02, 0xE9, [OPNFIL + 0x59] ; -   v%\Ubm2vvv'LqvLe{vxP mmvv-(    PvyvlvvvvvF $vvv/n c  * m 6 y *s   zv  +T0..&.\.& ..&τt2uGt6u.t.uVC.lZT^1.u.&.\.&Dg0zr$n`cG _ZtRS5[+[!vYt.{u.u؎ڱ3຀.U. .0\,;X=. " :@XutVtXtNtP<t,tBttbR 5[Cu2Cu!< u)< u CCMCD/t-&, t@ ;@uD$?t*tD/t tTi%rڈCځrsSCr[Khh ػD.\T Jx/t -Ks N u# tu±>u  0DS\UD]&&_SZSDU&< uCڻSP[rCtu)r8t"<.tE<:tIr!t4uru)< u r tJZS،R[[\Oð(tC<0r<:s<,0ĠtQrrrrr< s Yt$Yu#?YE8uE9uE:ԀeeE9XE82MuCRq[Et4uS?[=u#}=uS?[ue9GMɵPˊtÊEƄTz$ӊTj\lOW_SQYOWZWÊE E E E uBu=rBt3ECCE CE CE CE CSC[4tû0)uûӋE;u扜F ӊCDhCCCDwCDxCCCCCCD^|CCD~CCËtQS CDhCCCDwCDxCCCCCCD|CCD~CCZ Fû0)t(RӊE :uCE :uCE :uCE :[uϰùù<E$(uˇDSD]\UݺR!EtjDjtl\lztv0CDNNLNyuW;Lt>Nt;NsxNruWuWt]G5tS[tWuW9sSGH=uʉW[ ^>NtE"Du{vx|~yDjvPt7O-S#po>Pu؋PQDPEY[ Ìػv.0xD;:vGt QW@u¹S[YmCDO=ta>1rZstSsuR!u?u: vt.SPWXG[GS_&[R`DlDjQrVtjtlPDjllQXUHP$X@Q3Ƅ@DlY]XDlDjU Pv]YúR$v9t;ò_tRwt B Zyۋ1!ӺS&[tR0s S9e[Zy*Pӊ$Djrt Eu{7 DO;tjn&GP&wSAQYDOu [&GX&GDjSr+tt =uuu 5 uaDOÈDO&&&# t&C&$K&C&C&$&C$&:rB& Ȉ&:u CC&*t QLYuQYP&/CC&0J&6&ÁDjw DOuo u0LnQfu iut& tFDnt=Dn>u4AG uϰ'& &'[tM\t& YLnPxXt\\L00Ã:ruKK:ru CCC:rÊKKCCC3&&CC&7Lj$ň$ňŜ$C&C&/C&881 n rBR ^ rFu uZTU\\QDDSDDOD   DQDDUDDSDDOÊDU8#8DVt'RSDU[ZuLVu !ӉÈDO ӉðtȈSDUDDtm![É\QvY rD  r DOY Jt,& ht+u&'߰ uu&&oQ YË\u ?ڕ1&8u&G(tQS[Yu&&olt &0ËTu\UCD]Ê   {5Dwt \x\utOPteDetadalauDaDeX? Tu\x9ӉuTx%!LwZ\uDnPCDntU\Ut]\]ZD]DUXDn u6kCu-uStRC@u[u@\uÊDwt \x\uQYt0$O\u]tӊ(u \uڻ09t Uu\uË\uS[\uð \ut)uڋ\x9uDwt tuڻ09BBRdnt & t0[8uOCTU&yDi:u4BC t& tPt@&$Q$8Yu0Ç&$u<AQu+ctu:uYt,%DOÈDOY(tQM#Yû u+Sڻ،#GGG Z#0C&CP&CP&PS`[X&KX&KX&uuu @uË\uStu@t [\uytFcu.AQYuQ8uYtDOÈDOS Sl[u["zt2C0&'C؇ڈCڈڈGûGGu'u trt u$NMC&C&"C&"t:SQڻVts+s"t @u1rtY[Y[I뼽1ڊCCFEĝý1ڊCCFEĝ ً09Ë\u+C<,Ë\u\uË\u5 Ë\uË\u/tubtnui-u_S2 s!R\+ D-d!7-#[uCC'CCCC Z 0ÉډWt$ttu uuuuutRs\UD]tu}LnQs& tDn.YLnu\!tUruNouAL/D&WZRdӎŹv&C;D&j&KK&ZRZtt) t tCRQS[YZtuuDOu&Rt [\jS؋ll[;ASӋ9[sZtR_ZRau GG'&&"uC&tLuRS&CC& [Zt$ht&K&Ru&5Z|Z!ӊt R]ZZDOt RZtDOӋ_9rtuٻ!RӋt+SYZuJRSډ;Z\jDlnZA9sZuӊtRZ DO'P'RZXR/ZtDORD&w%Z0ûӋT+ ؋l-&CC& t!uF&CC&Ru/&PuBd/D&0XSPXZC&P&C&P&/C&P&SRWZ[X&KX&KX&[DOt0t uDOÉ 09t R[tË\UD]C0&ûӊC/CCCC DVt*Eu7DU&tDOÊDUNtDO Ӊ uD2U2tDO!! ÊDU9څË   DŽ !ٰtÇڋ!P;tG tS_[ߠt 0 QRS%ZYubG G G G G_G&İ>t)r(WSZڄuWO QR[ZYKY(ux5D&uo!ՊD( ȈD0D( D(tuvuD0u/D/@u)\(S0)Ӊ\(r{[\(t {y59t T1A2L\1Uy\1W9Ӊutw-@ttkt!lmtDt\1G_t0D&t\+D-T+l-D&tڕfD&t@KD0:rD( D0D(CD(CD)CD*CD/tD0C':DU$DV<s&DQÊDUctÊDUvlVt  Ӊt S[u9trӉ\1t:Ouŀu uPxGu@t2Q%tuY@ Y@tQgY utw\1ttAŀt<t$`<`u/Q ˋtSQY[DuFY9t Ӏ'߉tuËQYŀt QY0û09tS [t\1Ãd'D'VD':uFC0^d'uD0:r uD/tDmÀ'XtJD$:Dsudtu%_VCDF^\1GD"GD 0/Ջ\1\1t uú   \1ÊD')9OQSPˉPڊ:uBCB['KYyË\UD]2t6TDDDOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r uu;ËL$IDxA L\$\TDdx\ǀuڹA)syIAx )sڋ\ˋL D"D L \TڋLˇڋ\)s,Sˉ\Q ZuH\ LډӉ\7\C뻊D\T0)s؎otD:ttLDx\ÊD$¶ Ӌu%S*uDtDOË\UtàDOË\UD]&oO&G&&CIQS9[Yò :t&ut`t:tt::t!:t:t:uڀuW)tQY DgtȴÊ/_4tËuFCtjtl\j\lTnRDnƄ\ZTnDlDjtG*Ê< t<ut & ËDUuDn"u`t `YYuC)Ju4ڌ݋\UD] G G G$Sڱ[O$t觿DOà #ftS1[gZ t t:59 $tSDnPDnڱXDn[ËË)&/C&SC0P<t<< s<t4< t5<t<<t8XP8s&CXP< s@Q^VYNX[&uZXtPK&< sXPRSQR ZY[SQ'Y[SQY[Ë\UD]&O&G&IQ&CS[YË\UDT tLQS[Yt <sDhtTUt \Q"DOñ0ŀ @P[ SR]ZYu5QS]C[GNYOD[[GF_HW3R[0ËTQ\US[\U\Qq_ûPV @uD7@u DLb%^Xπd7D7@tL7L7@D7uwd7À  uÀ& x0\Ut\8\L @D:\T@lB|DdFTHDJ؎м& rt7W[  u#ƻ\Lx  tƎDJTHdF|DlBT@L>\ t 9 s r)+q uHûq )GË\U\QDOÉ)stW@@) qt/r9rڋt=r GËBB$20ËBB)Ӱr;r CCW0Ë\UWt59tG;tWRZWRZW뺋tHH;tG0ý"uVýuaý3tBý*tODStt)GtڰDODStDOËG+GG)GAOڋ+G7wG)OSPڻ X[GڻH9DSTUT]HGt ;r9r DOàPG>tu(HGt:Gs SQLY[G e  iXorKOGG7wG)OSڻH^[GPڻ BXDOXûH$ p q RQ YZù(Ct/:Gu2G;tG;u)ËGGáu⻋tGڋOډOU] puډwr0G+Gs/>t؀>u;s⺠t>uûHp:Gs rtËG t)ڋ+r PGQڋ)Ys ;Gr9X ڕ\UD]pݹ00vùCty$8u ;uCCQYô'd ĺ)sӄut 0PS-[XËGډGË_OWډO[.CtS[0 __v 1Ҏ¿`_ȫێډPPۿZXЫD t_ȫ(%؎.d^, &. .d^&, `.d^$$8u00 "a, &. VW.d^؎>D t 1ء=5uâRV1ػ _O2_^.d^ & .d^& `v v < u4> u- u> u> u   P  E  8~   *<~& u> u u ȍ ע á -  6  6 BBFÈ$ 0P%XË & %& u> t@1 H 1V ȣດúu8s   u ĺ죮 au <t< > u   G+@dv7[v.Rv%Iv@v7v .vÄt.Qڻ ?t P X Cڌ،YÄit* 8ذrBS ?t :r o*G[ tQSC&:u ACu[Y[Y {ʰtyăj8(:.n s# wVW0㋗ 0㋟o ҝ_^G!uËw# G!u SO_'[Gt)G!;Gs!G@tgWG  gOS<[w#;wrww#O!Gt0G t WG ҰËG7;G/rT0G7uGuG t WG ҰËG7;G/r)SQO_=SY[G7uG t WG ҰË9 G;-r19G7G WGG WG WOsV6o n 0QVW^Y^G 0 ÈÈO{ÈOtËW tO gߨ tOgOÊg3W  F t S_%[GG%G#GGS_/ [G1G;G9G/G-6G GuƄƄ@G%>q NjGuutu@t u  @ G3 O 86h gG@tW u OG tW 0FnÍ W $?t$0 g ÀO Í  W G u$Gt*Gt$:GuO:GugG uGt:uWW%W#G!!Gt7;r2OG@W tİG3$GttG;t)g %;r%G!Gt S_'Q[gÍ  GuG7u O (W (w;;w-rw1w;O7Gt S_=[gËW g Í  W tgG t OW Í  W @t GGt GG GG@0G 0 ÈÈOÈOËW tOgtO gߨ tO@g@tOgGËW 0Gt  10jȫ8S_[G#G%GGGS_/[G9G;G1G/G-W u utB0G%6 ƃJG t Gt Gt B0Gt G@t G u gG@t uOBO  f.d^ & .d^&` n t0W tC % "a & ϋW $t)t GGt GG GG@ËW G u$Gt*Gt$:GuO:GugG uGt:uWW%W#G!!Gt;;r6OG@tċW $GtċW  tG;t-g ؎%;u%G!Gt S_'[gGuG7uO (w;;w-rw1w;O7Gt S_=[gËW g ËW tgG t O "$ÊDgtDOÊDUtR8u"$    \ B9r. "CڋK9s"t(DV:tTjll)a)&*DOÈЄt< t]t'ty,tt 0 t$uq $CڋK9s$À>(t>)s&C&)uQ軯Yà)<s NﻯûuRQYZ<t <tÊY:rSuQ:.$,u6Y$<u-yQR:QR3ZYûPXuR Ztt[VÊ#CШBuà0)$N"úúú úÊ0à7Ètuà7}`BBBBڊڢ6Rn4h[ur>t Gr7S<r,t(6:rCItr4r0â7444Q''uÀ'z&CCCCCKuSPtX5t t @u^^t=[:[51' '4'? ư0@tS$[uÀ@'$ӊtt$dzOÉRӊY$dz.s.sӊ.sRBJJJBBBgaZ$ӊttsË(.Lr.C r.Pr.CrðJµRZsQYàu$4:stuR tJJZ<u'ZsÀn hRZu sÀzRBZ-s<u<tÊC4s0 sÈC0RQ uYZYJJZRQP쨀XuYZYJJZ¶HӠSHӠ*[<<à45¶ӊ'Ļ8ȶûX@Ȏ؎м1ػ8O<U =T6< t>เ>ʋ1؉ESì RP.$tXZR.$ tZPR.$t"ZX VW>61  xȫwȫ:<؎>t*0Q6 GY6/ G>E U>D uP .@ttf0 GU U OU U$]W>6_*06؋8tK U$PUX U($$_^QYQ YVW؎tu7&_^À>D u-t&R:u ZGOuRw>6>tJGG4GuGS>6[ZE>6WV^_Zփ>E RU$UUZ 8rvA02O60R؎UUWl_UU ($ZÉ0>N GGR6>Z0>N >F%uGtO_GtE U쨀$ud@t->D u tPVW6>S[_^[ZXփUUnU@uU GG0[ZX{O6PRZX>E (@t U $( @U .@u!($VW6>SG[_^G$>E U Ë>E U U$($S[6>o>E U쨀u1@tO%UUU U@tOGS[À>u`Rڠ8u ZGt=Gt7Gu1*G<E U$UU<uUU U UU ( ޺"a&@&Ȏ؎м  .@t0@t$Ժ 0n$". t$Pe0&IlX< t)1>@> " [ " 1؉E@  /#Guuu u&0G&0.y.yG.yGguD>E U쨀tU ES6>}[>E U쨀t GU WU@tGUu6NUn6RPn.6vxU.n.6|x.zx.nU .?<؎aAQIbˋ?t]m>Ft>VYÍ|iډ6>V؎T:avbӋ?U׹߉֊<r<uVWLz\ D ؉_^zD D =Fu$dDDt(r([SDD ,GDE tP\;] rH];\s\D] E׈Du0Lt-[S\ ML E<u<@r,@t^VƊ<s&<uPWV| LD zؾ^_X<r|RZ^6> È uK=Fu@VuD\:D t u^\ ] \ ] LEV[]^]\Ј^؋\ \ 0]mVW>V_^US>6؉6>[]1<r& >Fu ?tPX0GG>f6>~+GuCN1G>V4S w  _9[u!>V$t?zt7G >F)G >F'GG:Gr*GG@G GG#u~t0tG >F)G >F'gGG:Gr*GG@G EGP)vYOG2O GGYO#?tG u,G u&|u$Gt{uGtGte1Gt GutuG@tFu fO0ggPuGGt tÀOOlÀuGPG*`t< utG(DG@tCuGt GtgÀgߊG$KF'G >F) jgwGtGG$$:tFGGG0ËO:Os0GtGGtoGtt .tG@*G ÊG$Àg>F >F >:F rYGV>FGر G>FG>F>F/J3ô@>~->~- >~-gGGG G$GGu>F/ S^{[>F$t>F u>F  u >F  uX@ uLG>~- dG$GGG->N >F/S^[>f g>F$tËG#H>V G>F)P>f&X>F's>F&>V>F&>V>VB>~-G>F/S^[G>F$< t>~-G>F/S^g[>F$< t;t t- )G$> F%G=tO>F"0:GG u0>~- 6>F/zS^[>F$>~->F/Y>F2t>FGt @G GñG>N  >F >f >F >V>V>V>v-0>N/Q+uYY[>V>~00>N2Q&uYY<0JP쨀uXRBX0JuB0Q Yð>VtK>V$Vuuш$f>F >F2Ru^ý2>Ftým>FtVW؎|eP|\X_^Ê<t.<t0<t2<t9<tD$D>#u"t=fРVVW%T /DDD P&UXD sUUDT/DT/DD P&UXD s\UUDT/T DDDDDD TDÊT0V6$ >#u^"u#PSQxBtKuY[X#Y[XJ#SQxBu Ku#Y[JË >#u!V>#uW"uf;VWl0 0WtP/DD؉D AD AD"/>/r5@*2>"X B$uJJBt@J>#u+ >#uV>#uWVu VW0 BQ Y0></Ȣ@ouEA3<3>5t6<>ϡ0+<3>5u=r= r60<0035GDu^á3<;0s>3<<>à2<sWVߍ650 ^2ûh۷XËhՈG$t7$ tJu#$ uJu$u>Fձ u>F չ $@u JuGGÊG$>F GÊGpF Q$ t JuY Y>F C⿰[GÊG$t@>F >Ft@t'Ku!`HuG $ uGú$p<0t $@uJuհ؋G O ȜPЈЋG= v- G  G ࣘO O HYr*G סHш>N ѰfucQʋG PRHш>N Ѱ5u2Xш>N X@װuG tGSU|ɰA؊ֺՈ t@t Ju簉0P|X][Gá u`u$@t t>NG<@t f>FtP>F u ~uq>F duW0R>F պ$ t Ju4$ u Ju>F պ$ t Ju0GQ "u"uHtSU][㢑Y øÀtttJtNULF1øh=vtGUSVWQVWϾh&GF_^h__^[]1û %|1û|1ø7TurboDOS 1.43, Copyright 1986, Software 2000, Inc. $($/$)$ <-- $Invalid command$Command not found$Program load unsuccessful$Non-privileged user$ \>i   7COLDSTRTAUTWARMSTRTAUT ppttOSSLAVE SYSiii b Jpf, 5H.INIIIMI>]E]IIIG$1*1lu1(nL]31:1p]~]U ]A1 !T"X#^!:8h9`1l1 11XXXXY_ZGG0^"HII MvGU+VW\XUU11TTu$;H11#MK  ##$xEBB?B0MMOkQQ*Q2Q:QFQNQXH$v   DIRDSK,h (4ne{e{e{e{e{e{e{e{1.HHHHHHHHHHHHHIIII"I&I$ DSK $ ilc-PRINT- 000nnrrxx|| WnFtvv96 i `]0cfvvvvv@3;Zx0N CRTC b_*;Zx0Nm          * m 6 y vQdddde eee!e"emdg2hg^hg,hgXhNeVe]edeeSCC0ef@e` PE P% SCC1ef@end E, , PB B D@   P   rt~SK>)kYkjWjhhhhhACE0 ijh`  ' ACE1 ijh`   %& & ACE2 ijh` S S %i i ACE3 ijh`  % ACE4 ijh``  % ACE5 ijhh`   %2 2 ACE6 ijhp` _ _ %u u ACE7 ijhx`  ) ;@+&  C@*A m $ m@DHLPTX\ #vjj qvv||bq 1 > G^! " >&>&>&>&>&>%>' !>0%>ͷ ! F͞ ! ͮ w#Gͦo : (! [ S +~![ ^#V#N#F +* "$o > ͮ M~#ͷ ͮ w#$w O$o y [   dw                                50     DD 010>W(O( >!0F>_(˯@!0p#:0 (!0[0S00+~!(1^#V#N#F +*0"(1  FM<~~.~x~dnxs}}}M$#M$#M$# A  M##P#(#(#W@ A$B(CI 2J Hj HK*P &:G: 6 ( 5trF80 2F81 2F82 2F83 2F50 mF51 'mF52 LmF53 qm   ,,*}T}AHQgge}T}| (O P_(K(J (jPN Pn(/I (?M P?]>^e ~hM4M 4MMM =J4M M M           $- &/ (1!*3#, %. '0 )2"+          DW1100hhZ  RY1&ͅ܅8L\щGGG щTAPEFCNSNVwEOD^á3<;0s>3<<>à2<sWVߍ650 ^2ûh۷XËhՈG$t7$ tJu#$ u^;&== ; ; OLDSINGL.GEN TurboDOS v1.43+ h 03 Feb. 1987 ; ; These modules support a single user system on the model 1230 processor ; CNFTBL b ; Configuration table STDSINGL ; Modules for a single-user system without spooling CPMSUP ! ; CP/M Function Support ;MPMSUP ; MP/M Function Support ;QUEMGR '; MP/M queuing function support USRSOM " ; User Sign-On Message area, fill ed by OLDSINGL.PAR NIT186 ? ; Cold-start initialization, particularly hardware init XTISR /; Interrupt Sorter for Model 1230 board MEMTBL ' ; TurboDOS memory fragment tables RTC ; Real-time-clock driver CONSOL  ; Terminal handler ;SUBMIT 5; To emulate CP/M processing of $$$.SUB files USRSUP / ; To handle more than one USRFCN module PATCH ; Software 2000 Patch Area ; ;$===    === ; ; SERIAL I/O CONTROLLERS ; If you don't have any Model 630 or Model 480 I/O boards, choose SET ONE. ; With SET ONE, you can choose CONSOL and 1 printer. ; If you have one or more I/O boards, choose SET TWO. With SET TWO, you ; can choose as- many devices as you have serial ports. ; ;&== ; Set One ; ;XS3040 9; I/O driver 1230 SCC ports only ; ; Set Two ; XTSER ; Serial I/O handler: must be present XTSCC +; Serial driver for Model 1230 ports XTACE ?; Serial driver for Model 631 and 480 boards - "Asynchronous ; ; Communications Elements" ; ;&== ; ; PRINTER SELECTION ; How many printers you can choose depends upon how many serial ports you ; have available. Which drivers you choose depends upon your printers. ; Note: CTS and XON/XOFF are handled by the Pk1serial driver patches in the ; .PAR file ; ;&== ; LSTETX ! ; ETX/ACK Serial Printer LSTIMS $ ; Centronics Parallel Printer ; ;&== ; ; DISKS ; ; LFT supports three standard configurations: ; ; A. Floppies ; B. DMA winchesters (C01100 controller). ; C. RAM disk ; ; Choose one of the sets below accordingly. ; ; .KNOTE: TURBOGEN expects that "DSKDRA" is the floppy driver, and "DSKDRB" ; G is a winchester driver. If you want to use TURBOGEN, DO NOT change ; - the order of the modules listed below. ; ;&== ; ; A. Floppies ; FD930 u; Modules needed to run a Model 930 Floppy controller ; ; B. DMA winchester also choose A for floppies ; DW1100 @ ; Model C01100 controller (DMA) ; ; C. TurboDOS RAM Disk #; ;MDISK ; Module needed for TurboDOS RAM Disk Support ; ; NOTE: When using a TurboDOS RAM Disk, do not use Turbogen to modify ; the memory, buffer, or disk parameters. ; ;&==@ ; USER-WRITTEN DRIVERS ; If you have any, add them here. ;&== QIC02 USRFCN -/;&==' ; ; OLDSINGL.PAR TurboDOS v1.43+ ] 11 May 1987 ; ; This file contains patchable parameters for the file OLDSINGL.GEN ; ;&== ; USER INTERFACE ;&==z ; ABTCHR = 0x03 ; The sequence ATNCHR-ABTCHR will abort current process ATNBEL = 0x07 ; ATNBEL will be echoed when AZ{TNCHR is detected ATNCHR = 0x00 ; Halt process ECOCHR = 0x10 ; The sequence ATNCHR-ECOCHR will echo screen output to  ; to the current list device until ATNCHR-ECOCHR is retyped PRTCHR = 0x0C ; The sequence ATNCHR-PRTCHR will enqueue the print job RESCHR = 0x1E ; RESCHR, after ATNCHR, will resume process CLBLEN = 0x9D ; Longest legal command line = 157 bytes CLPCxHR = ">" ; Prompt character, displayed when OS ready for command CLSCHR = "\\" ; Command separator, for multiple com Qmands on one line ; ;&== ; LOGON ;&== ; AUTUSR = 0x80 ; Priviledged user 0 logon COLDFN = 0,"COLDSTRT","AUT" ; Drive # & file name for cold-start autoload WARMFN = 0,"WARMSTRT","AUT" ; Drive # & file name for warm-start autoload LDCOLD = 0xFF , ; Enable cold-start autoload LDWARM = 0xFF  ; Ena S  e&ble warm-start autoload LOGUSR = 0x1E l ; User logoff number = 30 USRSOM = 0x0D,0x0A,"L/F Technologies, TurboDOS-16 1.43+16d.01 (OLDSINGL)$" ; ;&== ; CONSOLE ;&== ; ; The patch points below are set for a console on Channel 0. If your ; console is on Channel 1, you must change "SDCB0" to "SDCB1" as well ; as the CONA  ST channel assignment. Each option listed here sets the ; baud rate to 9600. To change the baud rate, adjust the 2nd digit of ; CONBR according to the tables in Turbogen. ; Some commonly used rates are: ; ; x7 = 1200 baud xE = 9600 baud xF = 19200 baud ; CONAST = 0,(CONDRA) ; Console Channel # & driver entry point ; ; Choose the next two parameters if you have a "no protocol" terminal. ; CONBR = 0x8E 1 ; Console = 9600 baud, no protocol SDCB0+0x10 = 8 0x64 ; DTR high, bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have a CTS terminal. ; ;CONBR = 0xCE ; Console = 9600 baud, CTS ;SDCB0+0x10 = 0x64 ; DTR high, bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have an XON/XOFF terminal. ; ;CONBR = 0x9E ; Console = 9600 baud, XON/XOFF ;SDCB0+0x10 = 0x60 ; DTR high, bits-per-char = 8, protocol enabled ; ;* Buffer Parameters ; SDCB0+0x19 = (0x005 _o0) ; Input buffer size = 80. bytes SDCB0+0x2F = (0x0050) ; Output buffer size = 80. bytes SDCB0+0x1D = (0x0005) ; "Start Receive" threshold: send XON or raise CTS SDCB0+0x1F = (0x0045) ; "Stop Receive" threshold: send XOFF or drop CTS ; ;&== ; PRINTERS ;&==M ; ;* Serial Port Addresses ; ; LFT supports 5 configurations of serial devices. Each of ; these configurations starts with the two serial ports on the Model 1230 ; board (Channels 0 and 1). Usually, Channel 0 is the terminal. The other ; configurations depend upon your mixture of Serial Boards. ; ; If you have:  Choose: ; ; A. 1230 only:  2 serial devices:  no SET ; B. 1230 + 631: 4 serial devices:  SET 1 ; C. 1230 + 480: 6 serial devices:  SET 2 0 ; D. 1230 + 631 + 480: 8 serial devices: < SETS 1 & 3 ; E. 1230 + 480 + 480: 10 serial devices: ` SETS 2 & 4 ; ; SET 1: Choose this set for Configurations B and D ; ;SDCB2+0x0A = (0x00E0) ; Channel 2 (1st serial port on Model 631) ;SDCB3+0x0A = (0x00E8) ; Channel 3 (2nd serial port on Model 631) ; ; SET 2: Choose this set for Configurations C and E ; ;SDCB2+0x0A = (0x00E0) ;; Channel 2 (1st port on Model 480) ;SDCB3+0x0A = (0x00E8) ; *: Channel 3 (2nd port on Model 480) ;SDCB4+0x0A = (0x00F0) ;; Channel 4 (3rd port on Model 480) ;SDCB5+0x0A = (0x00F8) q; Channel 5 (4th port on Model 480) ; ; SET 3: Choose this set for Configuration D ; ;SDCB4+0x0A = (0x0060) ;; Channel 4 (1st port on Model 480) ;SDCB5+0x0A = (0x0068) ;; Channel 5 (2nd port on Model 480) ;SDCB6+0x0A = (0x0070) ;; Channel 6 (3rd port on Model 480) ;SDCB7+0x0A = (0x0078) 9; Channel 7 (4th port on Model 480) ; ; SET 4: Choose 8 this set for Configuration E ; ;SDCB6+0x0A = (0x0060) ?; Channel 6 (1st port on 2nd Model 480) ;SDCB7+0x0A = (0x0068) ?; Channel 7 (2nd port on 2nd Model 480) ;SDCB8+0x0A = (0x0070) ?; Channel 8 (3rd port on 2nd Model 480) ;SDCB9+0x0A = (0x0078) ; Channel 9 (4th port on 2nd Model 480) ; ;* Number of Serial Channels to be serviced ; ; Set NMBSER equal to the number of channels indicated by the configuration ; you chose above. ; NMBSER = 2 ; Configura ntion A ; ; ;* Printer Assignment Table: per order in OLDSINGL.GEN ; ; This table assigns a driver to each Channel in your configuration. Which ; driver is "LSTDRA" depends upon which one is listed first in OLDSINGL.GEN. ; ; The assignments for Channels 2 and 3 are commented out and are meant to ; serve as an example in case you need to add more drivers. ; PTRAST = 0x01,(SERIAL) ; Printer A = Channel 1, CTS printer 0xFF,(0000) ;Terminate the table with an "undefined" printer : t OW Í``]W @t GGt GG GG@0l$HSCC0bW  ` (PE aCC(P-aYYSCC1bW  nd (PE a(PZa D@   P    / rt~SK>)a(-aACE4b{o ` ` (aGG(a]]ACE5b{o h  sXTSERgCodeWAIT7DataSDCB0SDCB1SDCB2SDCB3SDCB4 SDCB5 SDCB6 SDCB7 SDCB8 SDCB9SDCBASDCBBSDCBCSDCBDSDCBESDCBFSERIALCOMDRVNMBSERSU_TBLKSPINIT:.`s# wVW0㋗`!0㋟` ҝ_^G! uËw# G! u SO_'[Gt)G!;Gs!G@tgWG  gOS <[w#;wrww#O!Gt0G t WG ҰËG7;G/rT0G7 uGuG t W $%G ҰËG7;G/ r)SQO_=Y[G7 uG t WG ҰË9 G;-r19G7G WGG W G WO sV6``0QVW^Y^````` ` ` ` ` ```````j*<$-1:CIJs       !$!4 ; 4 0x02,(SERIAL) ; Printer B = Channel 2, XON/XOFF ; 3 0x03,(LSTDRA) ; Printer C = Channel 3, ETX/ACK ; o 0x11,(LSTDRB) ; Printer D = centronics parallel printer (LSTIMS) ; ;* Driver Patch Points ; ETXBR = 0x0E B; ETX/ACK driver: Protocol = none, Baud rate = 9600 ETXLEN = 0x8C -; # fill characters for ETX (140) ETXSEQ = 3 / ; Length of ETX escape sequence ETXFF = 0x0C 3; ^L Formfeed for ETX/ACK printer ; IMSFF = 0x0C !; ^L Formfeed for centronics parallel printer ; ;* Channel Patch Points ; ; The patch points for Channels 2 and 3 are commented out and are meant to ; serve as an example in case you need to add more drivers. ; ; Channel 1, in the default config/uration, is a CTS printer ; SDCB1+0x0F = 0x6E 3; CTS, Input Disabled, 9600 baud SDCB1+0x10 = 0x64 @; DTR high, 8 bits-per-char, protocol enabled SDCB1+0x16 = 0x0C G; ^L End-of-print character = Formfeed SDCB1+0x19 = (0x0005) ; Inpu!t buffer size 5 characters SDCB1+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 2, in the example, is an XON printer ; ;SDCB2+0x0F = 0x1E ; XON, Input Enabled, 9600 baud ;SDCB2+0x10 = 0x64 ; DTR high, 8 bits-per-char, protocol enabled ;SDCB2+0x16 = 0x0C ; ^L End-of-print character = Formfeed ;SDCB2+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB2+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 3, in the example, is an ETX/ACK printer ;!q ;SDCB3+0x0F = 0x0E ; No protocol, Input Enabled, 9600 baud ;SDCB3+0x10 = 0x60 ; DTR high, 8 bits-per-char, protocol disabled ;SDCB3+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB3+0x2F = (0x0050) ; Output buffer size = 80. by tes ; ;&== ; SPOOLING ;&==D ; ; Spooling is not supported in OLDSINGL.SYS ; PRTMOD = 0 !i ) ; Default printmode = print direct ; ;&== ; PHYSICAL CONFIGURATION ;&== ; ;* Memory - choose the values of RAMBUL and TRKBUF according to the amount ; of memory in your system. All values are paragraph (segment) values. ; ; If you wish to have a RAM disk, choose the sub-set for your ; memory size and RAM disk s ize. Note! that RAM disk is not supported ; on masters with less than 512k bytes of memory ; ; SET ONE - for 256K bytes ; RAMBUL = (0x33C0) :; Top of TPA (No RAM disk recommended) TRKBUF = (0x3C00) (; Floppy Track Buffer BUFBAS = (0x3400) ; Start of External Buffer Area ; ; SET TWO - for 512K bytes ; ;RAMBUL = (0x73C0) ; Top of TPA with no RAM disk ;TRKBUF = (0x7C00) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0x7400) ; Start of External Buffer Area with no !RAM disk ; ;RAMBUL = (0x53C0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0x5C00) ; Floppy Track Buffer with 128k RAM disk ;BUFBAS = (0x5400) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0x6000) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0x33C0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0x3C00) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0x3400) ; Start of Exter!nal Buffer Area with 256k RAM disk ;RDBAS = (0x4000) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ; SET THREE - for 1024K bytes (one megabyte) ; ;RAMBUL = (0xEFC0) ; Top of TPA with no RAM disk ;TRKBUF = (0xF800) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0xF000) ; Start of External Buffer Area with no RAM disk ; ;RAMBUL = (0xCFC0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0xD800) ; Floppy Trac! k Buffer with 128k RAM disk ;BUFBAS = (0xD000) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0xDC00) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0xAFC0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0xB800) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0xB000) ; Start of External Buffer Area with 256k RAM disk ;RDBAS = (0xBC00) ; Base of RAM disk with 256k RAM disk ;RDLEN = !!. Gu  u   t u  @t   u   @    G3   O RW50G66`p gG@t W u O G t     W 0Fn.``0&`2.`&`0`.` `NÈĈű0$0 Ãw7㋟`W  $?tڠ`N$0`4g O W 8 " a`0&`2ωӋW G!\ u$Gt*Gt$:GuO :GugG u Gt:` uWW%W#G! !Gt7;r2OG@W tİG3$GttG;t)g %;r%G!Gt S_'[gÉGuG7 u O (W )w;;w-rw1w;O7 G= t S_=[gËW g ÉӋW tgG t OW ÉӰW @t GGt GG GG@07C0!h6l$HVECSTAT D@   P !cW  / rt~SK>)SIO0bW nd (PEa#P#,aSIO1bW nd (PEa#P#,aSIO2bW nd (PEaHH#P#,a^^SIO3bW nd (PEa#P#,aSIO4bW nd (PEa#P#,aSIO5bW nd (PE a#P! #,a''SIO6bW nd (PEaTT#P #,ajjSIO7bW nd (PEa#P #,aSIO8bW nd (PEa#P!#,aSIO9bW nd (PEa#P!#,a33SIOAbW nd (PEa``#P0#,avvSIOBbW nd (PEa#P0# a!Z%?-!!!tXTSCCQCodeALLOCATNCHRSIGNALDataCSWTCHSCCISRSDCB0]SDCB1 G 0`È ÈO {ÈO tËW tO gߨ tOgOÊg3W  `t  S_[GG%G#GGS_/[G1G;G9G/G-6`GuƄ Ƅ @G% >`Nj  Gu  u   t u  @t   u   @    G3   ! O 86` gG@t W u O G t  W 0FnÍ`W $?t$0` g ÀO Í``]W G u$Gt*Gt$:GuO :GugG u Gt:` uWW%W#G! !Gt7;r2OG@W tİG3$GttG;t)g %;r%G!Gt S_'[gÍ``]GuG7 u O (W (w;;w-rw1w;O7  Gt S_=[gËW g Í``]W tgG ""4 (0x4000) ; Size of RAM disk with 256k RAM disk ; ;RAMBUL = (0x8FC0) ; Top of TPA with 384k RAM disk ;TRKBUF = (0x9800) ; Floppy Track Buffer with 384k RAM disk ;BUFBAS = (0x9000) ; Start of External Buffer Area with 384k RAM disk ;RDBAS = (0x9C00) ; Base of RAM disk with 384k RAM disk ;RDLEN = (0x6000) ; Size of RAM disk with 384k RAM disk ; ;RAMBUL = (0x6FC0) ; Top of TPA with 512k RAM disk ;TRKBUF = (0x7800) ; Floppy Track Buffer with 512k RAM di"sk ;BUFBAS = (0x7000) ; Start of External Buffer Area with 512k RAM disk ;RDBAS = (0x7C00) ; Base of RAM disk with 512k RAM disk ;RDLEN = (0x8000) ; Size of RAM disk with 512k RAM disk ; ; ; ROM starts at 0xFC000, which is the eflfective end of memory ; ; IF YOU PLAN TO USE TURBOGEN, DO NOT CHANGE OSMLEN & OSMTOP ; OSMLEN = (0x1000) E; Reserved memory for buffers and working storage OSMTOP = (0x0000) ; Absolute top paragraph ; ;=="Fu== ; DISKS ;&== ; ; If you change BUFSIZ & NMBUFS, change RAMBUL, TRKBUF, BUFBAS, and BUFLEN ; to reflect the new buffer requirements ; BUFSIZ = 6 * ; Disk buffer size = 8K bytes NMBUFS = 4 ? ; # disk buffers allocated at cold-start (4) BUFLEN = (0x800) 0 ; Number of paragraphs in BUFBAS ; SRT431 = 3  ; 6 msec step rate for Shug"art 5" drives SRT401 = 8 ~ ; 8 msec step rate for Shugart 8" drives ; ; Disk Assignment Table ; DSKAST = 0x00,(DSKDRA) ; Drive A = floppies  0x01,(DSKDRA) ; B  0x02,(DSKDRA) ; C  0x03,(DSKDRA) ; D  0x04,(DSKDRA) ; E  0x05,(DSKDRA) ; F  0x06,(DSKDRA) ; G  [0x07,(DSKDRA) ; H ; ; Choose one of the next two Sets depending upon whether "%hyou have a ; Winchester controller. ; ; SET ONE: choose this set if you do not have a winchester. ; 6 0xFF,(0x0000) ; Drive I is not in the system ; 6 0xFF,(0x0000) ; Drive J is not in the system ; 6 0xFF,(0x0000) ; Drive K is not in the system ; 6 0xFF,(0x0000) ; Drive L is not in the system ; 6 0xFF,(0x0000) ; Drive M is not in the system ; 6 0xFF,(0x0000) ; Drive N is not in the system ;  0xFF,(0x0000) ; Drive" O is not in the system ; 0xFF,(0x0000) ; Drive P is not in the system ; ; SET TWO: choose this set if you have a 1100 DMA winchester controller. ;  00x00,(DSKDRB) ; Drive I = DMA winchester  0x01,(DSKDRB) ; J  0x02,(DSKDRB) ; K  0x03,(DSKDRB) ; L  0x04,(DSKDRB) ; M  0x05,(DSKDRB) ; N  0x06,(DSKDRB) ; O  0x07,(DSKDRB) ; P "ԍ; ; If using a TurboDOS RAM Disk, the RAM Disk must be mapped into the Disk ; Assignment Table. ; ; 0x00,(DSKDRC) ; Substitute this value into the drive position ; ; you wish the RAM Disk to reside. ; ; NOTE: When using the Tur0boDOS RAM disk, DO NOT use Turbogen to modify ; -the memory, buffer, or disk parameters. ; ;&== ; MISCELLANEOUS ;==="'A=== ; COMPAT = 0xB0 B; File Access: Permissive, global-write, mixed mode CPMVER = 0x31 7; CP/M BDOS version returned by C-fnc 12 SRHDRV = 0xFF >; Search drive for command files = system disk JDATE = 0x3639 ' ; Cold-start date = Jan 01, 1986 ; ;&== ; PATCHES ;&== ; ; Patch 1.43-" 01 ; ; The following patch is applicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fcn 15 opening the ; files $.DIR or $.DSK when FCB byte 32 is FF. The ; 'PATCH' module must be included during system generation. ; OPNFIL + 0x4A = [PATCH] PATCH = 0xE8, [CKSPFN], 0xB0, 0x00, 0x74, 0x03, 0xE9, [OCECOM],  ,0x83, 0xC4, 0x02, 0xE9, [OPNFIL + 0x59] ; $ "("XTACE+CodeALLOCSYSSEGNMBSERATNCHRSIGNALDataSDCB2USDCB3SDCB4SDCB5SDCB6aSDCB7SDCB8SDCB9 G 0`È ÈO ÈO ËW tOgtO gߨ tO@g@tOgGËW 0Gt  1 0`oȫ  8S_[G#G%GGGS_/[G9G;G1G/G-W u utB0G% 6`*ƃJG t Gt Gt B0Gt "G@t G u gG@t   uOBO .``J&`L.`&````t0W tC % ` "a`J&`LϋW $t)t GGt GG GG@ËW G u$Gt*Gt$:GuO :GugG u Gt:` uWW%W#G! !Gt;;r6OG@tċW $GtċW  tG;t-g ؎%;u%G!Gt S_'[gGuG7 uO (w;;w-r"(w1w;O7  Gt S_=[gËW g ËW tgG t Oh $gACE0b{o ` (a;;(-aQQACE1b{o ` (a~~(-aACE2b{o ` (a(-aACE3b{o ` (a(-aACE4b{o ` ` (aGG(a]]ACE5b{o h" ` (a(-aACE6b{o p ` (a(-aACE7b{o x ` (a(+a&&?;@+&  /S = (0xD000) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0xDC00) ; Base of RAM disk with 128k RAM"XTISRCodeGETSDSUndDataDataSCCISRISRVI0ISRVI3WDCISR FDCISR SLVISR ISRVI7 ISRV00SYSSEGISRINIyADDRSTBLxMASTERdINT_SRVWHERAMI .`؎ ijp8u`{  ` `y`x (>`d `` 1Ҏ¿ ` ȫێډ PP ۿ ZXЫ`xt `ȫ (%  ؎.```&`b.`&``"L`.` $$8u0`d  "a``&`b? /j`!```` ` ` ` `!4t""" jXTS1250CodeALLOCSYSSEGSU_TBLATNCHRSIGNALDataxt_s1250SDCB2SDCB3SDCB4bSDCB5SDCB6SDCB7+SDCB8nSDCB9SDCBASDCBB7SDCBCzSDCBD G 0`<È hÈO ÈO ËW tO gߨ tOgOÊg3W  À>`Ft$1 0`ȫ  8 0`FS_[GG%G#GGS_/[G1G;G9G/G-6`OGuƄ Ƅ @G% >`yNj  #6###%=U  0URwMVv[PLL*T    U|x    Z &jD( k O  [  VX  p` ,60..&.=.& ..&τt2uP+t6u.t.u VC.::^1.u.&.=.&Dg0f ^ $nL cG K Q:tRS5[+[!#k-:t.Ku.UOu؎ڱ3຀.U. .0\,' 49)      : @w utVtXtNtP<t,tBt7, Track: \6+7, Sector: \S6[TJtS 7 - [66 (Retry, <t 6Ignore, 6Abort) *,tF,A,P,#X6.(t$.(tbR 5[Cu2Cu!< u)< u CCMCD/t-&, t@ ;@uD$?t*tD/t tTi%rڈCځrsSCr[Khh ػD.\4 #x/t -Ks N u# tu±>u  0DS\UD]&&_SZSDU&< uCڻSP[rCtu)r8t"<.tE<:tIr!t4uru)< u r tJZS،+3[[\Oð(tC<0r<:s<,0ĠtQ#rrrrr< s Yt$Y `7 ` ``  8` tW ߍ6`VW u _^ u q_^GuUW S_ t[PvGG P[GG%G#GGS_/ t[/PvG/ P[G1G;G9G/G-0ðÍ> `#Guƅ ƅ @G% 6`ƭ  Gu  u   t u  @t   u   @    t``   O 6` PGtG@t W 8 tgO>`G@t  G t 6` 6`W 0Fn.` `&`.`& `^`؎  "a`&`ύ`GW  ? $?t 3$0`7 g ÀO Í`G`W #& zG u$Gt*Gt$:GuO :GugG u Gt3: ` uWW%W#G! `u: `t` `u !GtB;r=OG@W t u ``$   tG ;t)g %;r%G!Gt S_' [gÍ `G`GuG7 uO (W :(w;;w-rw1w;O7  Gt S_= [gËW g Í `G`W # tgG t OW Í`G`W @tGGGu. #)#tGG Gu GG@0 {Ü>` u,QWV׉ƺ  %  ^_YÜ>` u+QWV׉ƺ  %  ^_YÜ>` u&QWV׉ƺ  %  ^_YÜ>`B u&QWV׉ƺ  %  ^_Y aG-Nr*<(/3:`fg;k5eSCC0ah{! ` (PE app(PE3aSCC1ah{! nd (PE#3 a(Pca ! D@   P   ? rt~SK>)-##  $$DO#.rKDSu<2%Djrt Eu{2(7 DO$;tjn&GP&wSAQYDOu [&GX&GDjSr+tt =u''u ' u'DOÈDO&&&# 't&C&$K&C&C&$&C$&:rB&Ȉ&:u CC&*t QLYuQ'YP&/CC&0J&6&ÁDjw DOuo u0LnQfu iut& tFDnt=Dn>u4AG uϰ'& &'y&tMo&t& YLnPxXt\\L0$0Ã:ruKK:ru CCC:rÊKKCCC3&&CC&7Lj$ň$ňŜ$C&C&/C&%1 n rBR ^ rFu uZTU\\QDDSDDODDQDDUDDSDDOÊDU|%DVt'RSDU%[ZuLVu !ӉÈDO ӉðtȈSDUDD$t[É\QvY rD  r DOY JXt)r(WSZڄuWO QR[ZYUY[(uZx5[D&uy!dfՊD( ȈD0D( D(tuvuD0u/D/@u)\(Sf0)Ӊ\(r{[\(t {y5\\9t T1A2Lb\1Uy\1W`9Ӊutw-@ttkt!lmtDt\1G_t0D&t\+D-T+l-D&tڕpD&t@KD0:rD( D0D(CD(CD)CD*CfD/tD0C':DU$ZDV<s[Z&[DQÊDU%Z)tÊDUvlVt  Ӊd`t S[u`9trӉ\1t:Ouŀu uPxGu@t2Q%tuY@ Y@tQgY utw\1ttAŀt<t$`<`u/QjˋtSQY[DuY``9t Ӏ'߉tuËdQYŀt QY0û``09tS [t\1Ãd'D'VD':uFC0^d'uD0:r uD/tDmÀ'XtJD$Z:Dsu tu%_VCDF^\1GD"GD 0%/\1\\1~`  uú   \1ÊD')``9QSˉhhڊ:uBCB['KYyË\UD]<t6TDDDOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r uu;ËL$IDxAL\$$\TDdx\ǀuڹA)syIAx )sڋ\ˋL D"D L \TڋLˇڋ\)s,Sˉ\Q ZuH\ LډӉ\7\C뻊D\T0)s؎otDt%~tVDx\ÊD$¶jӋu%S*uDtt;sxruWuWt]xGvv5t%S:[txWuW9sSvGxH=uʉW[ ^>tE OuKFHLNIODjF t7O-Spo> u؋ Q8 EY[ ÌػF.O0O;:FGt QvW@u¹xS[Y DO=ta>|1rZCtSCE"!݄u?u: Ft.SPWXG[GS_&["ݏDlDjQrVtjtlPDjllQXUHP$X@Q3Ƅ@DlY]XDlDjU  F]Y% ú"6݄$Fzv9U DU|DO\_Ë\UD]&R&G&G[* P$X$t DO&Gñ ܁*؋\UD]&&G&G, s ËDU=t}á}DOÀDS0t DTDUBDQË\QLjTUDlsTULS\QDO< s< t < t< t<uPXDOÊDU< s(< t < u$$*Q Y DOÊLUDUtttt otmDOË\UD]&C:t S[Ë\UD]>DOË\UtàDOË\UD]&O& %% Mu 0Ë`[`Z`cT A)sy`X```^ `[u`Zþ`c LVQL ݉Y ^ñDHt$, `Tà`P`P<s0`P`Q`Q<s0`Q.`P`Q u `^  P8 POSLOAD CMD X !0$t of External Buffer Area with 512k RAM disk ;RDBAS = (0x7C00) ; Base of RAM disk with 512k RAM disk ;RDLEN = (0x8000)%%%eTPCSUPOriginBUnitCodeSELFCBGETCRAGETS1AOPNFILFND1FPGETTFFFNDNXT GETTFL LDIR LOKFIL CFSFIL FREFILMAKFILRESFCBCKLCOMMAKLOKFNDLOKFRELEPLOKOFFLOKLENTOFFCNTMFFCNTLRFCNTFRFCNSFLFCNHRFLFCNhCHKTFF|Qt&&DTu6|Qu3\uSt)u ،Ź  [\u JDO[S\u%= [\u u&'&tC&(C&C&&K&K&Ks& ڌݹ  &DTu  CÈDOu t uDOu tuDOu& t  ڋ\jDlݹ  ÈDO uTjll ع  ÈDOt  $u Ë\j` Dl ` `%%%RUSRFCNwCodeTUDCBUndDataGETSDSTRBSZTDRVRDMXSPHSIGNAL WAIT DataUSRIN_USRFC_  `ÀtttJtNU LF1ø`=`tGUSVWQVWϾ`` &GF_^`_` _^[]1û`1û` 1ø TAPEFCNSs72gFË"ڋD Dlicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fc%  &&2G&&CIQS9[Yò :t&ut`t:tt::t!:t:t:uڀuWtQY DgtȴÊ/_r tËuFCtjtl\j\lTnRDnƄLZTnDlDjtG*Ê< t<ut *ذ \ ËDUuDn&u`t `YYuC)Ju4ڌ݋\UD] V G G G$Sڱ[O$tDOÃ6#ftS1[&Tt t:5w$tSDnPDnڱXDn[ËË)&/C&SC0P<t<< s<t4< t5<t<<t8XP8s&CXP< s@Q^VYNX[&uZXtPK&< sXPRSQR ZY[SQ'Y[SQY[Ë\UD]&O&G&IQ&CS[YË\UDT tLQS[Yt <sDht\Uuly ]x0uËKtû0ÉSZӉSYCË&6&SQRt7W[ZY[áá&u p`:> t 9 s r)+uH(û)GË\&U\QDOÉ*)s*.,""tW*@@)t/r9.r.,ڋ,t.=r GË*BB$20Ë(*BB)Ӱr;&r (CCW0Ë\U,W""t5,9tG;,tWRZ,WRZW뺋,"""tHH;(tG(0ý"uVýuaý3tBý*tODStt.)GڰDODStDOËG+GG)GAOڋ+G7wG)OS3P3ڻ4X3[Gڻ\9DSTUT]\Gt ;r9r DO&3PG3>u(\Gt3:Gs SQLY[GX3orKOGG37wG)OSڻ\^[G3P3ڻ4BX3DOX3û\$43RQ4YZù(C0t/3:Gu2G;tG;u)ËGGá0u0⻋0t3GڋOډOU]42uډwr0G+Gs/>2t؀>22u;.s.,⺠2,t>22u.û\3:Gs rtËG t)ڋ+r PGQڋ)Ys ;Gr9&X ڕ\UD]ݹ3300ùCty$8u ;uCCQYô'd ĺ)sӄut 0PS[XËGډGË_OWډO[.CtS[؎ijp8u (>? 1Ҏ¿?ȫێډPPۿZXЫtP?ȫ(%؎.>&.>&`.>$$8u0"a&VW.>؎>t 1ء=5uâRV1ػ ?O2_^.&(>#&%.>&#`<؎<u?<u <u B_^ZY[Gúu.úu&[E F G Í6E1R1ZuBBF纜1K1M1NÀ>Mu4>Ju-Ku>Nu>Iu J IPIKEJM8~ KN*<~&Ku>NuIuJJȍgעIáK-JN6I 6EBBFÈ$ 0P%XË& K&s%&u u>Nt@1JHO1Iȣດúu8sE F G u ĺNKauJ<t< >Iu INGàzu#<u<u,t*t&zRQxqyt YQaYZ _@ 7.% Ät.Qڻ}?t P|X|Cڌ،jYÄt*|8ذrBS}?t :r o*G[}tQSC&:u ACu[Y[Y ܰtփ & &eed by C-fnc 12 SRHDRV = 0xFF >; Search drive for command files = system disk JDATE = 0x3639 ' ; Cold-start date = Jan 01, 1986 ; ;&== ; PATCHES ;&== ; ; Patch 1.43-01 ; ; The following patch is applicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fc&On 15 opening the ; files $.DIR or $.DSK when FCB byte 32 is FF. The ; 'PATCH' module must be included during system generation. ; OPNFIL + 0x4A = [PATCH] PATCH = 0xE8, [CKSPFN], 0xB0, 0x00, 0x74, 0x03, 0xE9, [OCECOM],  ,0x83, 0xC4, 0x02, 0xE9, [OPNFIL + 0x59] ; 5LING ;&== ; PRTMOD = 1  ; Default print&&&|SUBMITOriginBUnitDataZCodeOCNTRYOTNTRYSUBFNSUBMITTENASUB $$$ SUB`tL`t;`ڱ3``u ``RZ!``0e on masters with less than 512k bytes of memory ; ; SET ONE - for 256K bytes ; RAMBUL = (0x33C0) ; Top of TPA (No R&&&& _TDLDRnCode &`P`Q ؉Ȏ <tȎ .`c Ȏؾ`c $D`U1```Z`b`S`RD `X  >`UtB&:`Sr`S&`R `T (s `X &G 뷠`S `RȾ`cLH@`W`XS[C0`cDHt7CSӊ$*D0QY`[`Z`] {t[ ```Wu[  `]u St  1`^ &u`E &.*G$u `b`U΃`Uu >`bu ''15:.s# wVW0㋗0㋟ҝ_^G!uËw# G!u SO_'][Gt)G!;Gs!G@tgWG  gOS<[w#;wrww#O!Gt0G t WG ҰËG7;G/rT0G7uGuG t WG ҰËG7;G/r)SQO_=Y[G7uG t WG ҰË9 G;-r19G7G WGG WG WOsV60QVW^Y^G 0 ÈÈO{ÈOtËW tO' gߨ tOgOÊg3W   t S_[GG%G#GGS_/[G1G;G9G/G-6 GuƄƄ@G%> NjGuutu@t u  @ G3 O 86 gG@tW u OG tW 0FnÍ( W $?t$0 g ÀO Í( k W G u$Gt*Gt$:GuO:GugG uGt:uWW%W#G!!Gt7'g;r2OG@W tİG3$GttG;t)g %;r%G!Gt S_'[gÍ( k GuG7u O (W (w;;w-rw1w;O7Gt S_=[gËW g Í( k W tgG t OW Í( k W @t GGt GG GG@0G 0 ÈÈOÈOËW tOgtO gߨ tO@g@tOgGËW 0Gt  10Jȫ8S_L[G#G%GGGS_/3[G9G;G1G/G-W u ut'B0G%6$ ƃJG t Gt Gt B0Gt G@t G u gG@t uOBO .>D &F .>& ` t0W tC % "aD &F ϋW $t)t GGt GG GG@ËW G u$Gt*Gt$:GuO:GugG uGt:uWW%W#G!!Gt;;r6OG@tċW $GtċW  tG;t-g ؎%;u%G!Gt S_'`[gGuG7uO (w';;w-rw1w;O7Gt S_=$[gËW g ËW tgG t O uRQ YZ<t <tÊ Y: rSuQ:.$,u6Y$<u- yQRQRZYû  PX uR Ztt [VÊ   CШuà 0)$ X﻽ "úúú úÊ 0؎ AQI ˋ?t]m>Ft>VYÍ SX6 > V؎T: v Ӌ?U׹߉֊<r<'juVWL \ D ؉_^ D D =Fu$dDDt(r([SDDGDE tP\;] rH];\s\D] E׈Du0Lt-[S\ ML E<u<@r,@t^VƊ<s&<uPWV| LD  ؾ^_X<r RVZ^6 > È uK=Fu@VuD\:D t u^\ ] \ ] LEV[]^]\Ј^؋\ \ 0]mVW>V_^US> 6 6 > []1<r& >Fu ?tPX0 GG>f6 >~+GuCN1G>V4S9[u!>V$t?zt7G >F)G >F'GG:Gr*GG@G GG#u~t0tG >F)G >F'gGG:Gr*GG@G EGP)vYOG2O GGYO#?tG u,G u&|u$Gt{uGtGte1Gt GutuG@tFu fO0ggPuGGt tÀOOlÀuGPG*`t< utG(DG'x@tCuGt GtgÀgߊG$KF'G >F) jgwGtGG$$:tFGGG0ËO:Os0GtGGtoGtt .tG@*G ÊG$Àg>F >F >:F rYGV>FGر G>FG>F>F/J3ô@>~->~- >~-gGGG G$GGu>F/'  S^{[>F$t>F u>F  u >F  uX@ uLG>~- dG$GGG->N >F/S^[>f g>F$tËG#H>V G>F)P>f&X>F's>F&>V>F&>V>VB>~-G>F/S^[G>F$< t>~-G>F/S^g[>F$< t;t t- )G$> F%G=tO>F"0:GG u0>~- 6>F/zS^[>F$>~->F/Y>F2t>FGt @G GñG>N  >F >f >F >V>V>V ''+ ; ; SET THREE - for 1024K bytes (one megabyte) ; ;RAMBUL = (0xEFC0) ; Top of TPA with no RAM disk ;TRKBUF = (0xF800) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0xF000) ; Start of External Buffer Area with no RAM disk ; ;RAMBUL = (0xCFC0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0xD800) ; Floppy Track Buffer with 128k RAM disk ;BUFBAS = (0xD000) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0xDC00) ; Base of RAM disk with 128k RAM' disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0xAFC0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0xB800) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0xB000) ; Start of External Buffer Area with 256k RAM disk ;RDBAS = (0xBC00) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ;RAMBUL = (0x8FC0) ; Top of TPA with 384k RAM disk ;TRKBUF = (0x9800) ; Floppy Track Buffer 'with 384k RAM disk ;BUFBAS = (0x9000) ; Start of External Buffer Area with 384k RAM disk ;RDBAS = (0x9C00) ; Base of RAM disk with 384k RAM disk ;RDLEN = (0x6000) ; Size of RAM disk with 384k RAM disk ; ;RAMBUL = (0x6FC0) ; Top of TPA with 512k RAM disk ;TRKBUF = (0x7800) ; Floppy Track Buffer with 512k RAM disk ;BUFBAS = (0x7000) ; Start of External Buffer Area with 512k RAM disk ;RDBAS = (0x7C00) ; Base of RAM disk with 512k RAM disk ;RDLEN = (0x8000)'Dk ; Size of RAM disk with 512k RAM disk ; ; ; ROM starts at 0xFC000, which is the effective end of memory ; ; IF YOU PLAN TO USE TURBOGEN, DO NOT CHANGE OSMLEN & OSMTOP ; OSMLEN = (0x1000) E; Reserved memory for buffers and working storage OSMTOP = (0x0000) ; Absolute top paragraph ; ;&== ; DISKS ;&== ; ; If you chang'Dve BUFSIZ & NMBUFS, change RAMBUL, TRKBUF, BUFBAS, and BUFLEN ; to reflect the new buffer requirements ; BUFSIZ = 6 * ; Disk buffer size = 8K bytes NMBUFS = 4 ? ; # disk buffers allocated at cold-start (4) BUFLEN = (0x800) 0 ; Number of paragraphs in BUFBAS ; SRT431 = 3 5 ; 6 msec step rate for Shugart 5" drives SRT401 = 8 | ; 8 msec step rate for Shugart 8" drives ; ; Disk Assignment Table ; DSKAST = 0x00,(DSKDRA) ; Drive A = floppies'  0x01,(DSKDRA) ; B  0x02,(DSKDRA) ; C  0x03,(DSKDRA) ; D  0x04,(DSKDRA) ; E  0x05,(DSKDRA) ; F  0x06,(DSKDRA) ; G  0x07,(DSKDRA) ; H ; ; Choose one of the next two Sets depending upon whether you have a ; Winchester controller. ; ; SET ONE: choose this set if you do not have a winchester. ; 3 0xFF,(0x0000) ; Drive I is not in the system' ; 6 0xFF,(0x0000) ; Drive J is not in the system ; 6 0xFF,(0x0000) ; Drive K is not in the system ; 6 0xFF,(0x0000) ; Drive L is not in the system ; 6 0xFF,(0x0000) ; Drive M is not in the system ; 6 0xFF,(0x0000) ; Drive N is not in the system ; 6 0xFF,(0x0000) ; Drive O is not in the system ; 0xFF,(0x0000) ; Drive P is not in the system ; ; SET TWO: choose this set if you have a 1100 DMA winchester controller. 'E ;  00x00,(DSKDRB) ; Drive I = DMA winchester  0x01,(DSKDRB) ; J  0x02,(DSKDRB) ; K  0x03,(DSKDRB) ; L  0x04,(DSKDRB) ; M  0x05,(DSKDRB) ; N  0x06,(DSKDRB) ; O  0x07,(DSKDRB) ; P ; ; If using a TurboDOS RAM Disk, the RAM Disk must be mapped into the Disk ; Assignment Table. ; ; 0x00,(DSKDRC) ; Substitute this value into the ' adrive position ; ; you wish the RAM Disk to reside. ; ; NOTE: When using the TurboDOS RAM disk, DO NOT use Turbogen to modify ; -the memory, buffer, or disk parameters. ; ;&== ; MISCELLANEOUS ;&== ; COMPAT = 0xB0 B; File Access: Permissive, global-write, mixed mode CPMVER = 0x31 ; CP/M BDOS version return ((#>v-0>N/Q+uYY[>V>~00>N2Q&uYY<0JP쨀uXBX0JuB0Q Yð>VtK>V$Vuuш$f>F >F2Ru^ý>Ftý>FtVW؎ P 2X_^Ê<t.<t0<t2<t9<tDt>surt=Eߠ% DDD P(&XD sDDDD P&XD sD DDDDDD DÊ0V6tp>su^rusPSQxBtKuY[XsY[XJsSQxBu KusY[JËp>su!좦>su좧ru0 0WtPDD؉D D Dr>r*>rXpB$uJJBt@J>su+ >su좦>su좧u (,0pBQ Y0ȢouEtࣆϡ+>u=r= rࣆ0GDuFձ u>F չ $@u JuGGÊG$>F GÊGpF Q$ t JuY Y>F C⿰[GÊG$t@>F >Ft@t'Ku!`HuG $ uGú$p<0t $@uJuհ؋G O ȜPЈЋG= v- G  G O O HYr*G סH(Oш>N ѰfucQʋG PRHш>N Ѱ5u2Xш>N X@װuG tGSU ذA؊ֺՈ t@t Ju簉0P X][Gá u`u$@t t>NG<@t f>FtP>F u ~uq>F duW0R>F պ$ t Ju4$ u Ju>F պ$ t Ju0GQ "u"uHtSU)][Y øÀtt(etJtNULF1ø=tGUSVWQVWϾ&GF_^__^[]1û 1û 1ø7TurboDOS 1.43, Copyright 1986, Software 2000, Inc. $($/$)$ <-- $Invalid command$Command not found$Program load unsuccessful$Non-privileged user$ \>A(O,COLDSTRTAUTWARMSTRTAUT0*1J11151x==11190$$XarZ=$&$==A=-$@DR>L$X$ z$$99&9/99:`-I00j>0115,0778$$66a0$$I3  *''',55N6Z6f6n6v6661~ 6DIRDSK4\\``(HjMMMMMMMMVVVVVVVV.,,,,,,,,,,,,,C-F-J-N-T-X-$ DSK1$ B( cjD96""]7 L/F Technologies, TurboDOS-16 1.43+16d.01 (OLDSINGL)$ 0 (r(D ; When using this patch, however, TurboGEN must NOT be used. ; ; E 0x00,(LSTDRB) ; Printer D = centronics parallel printer (LSTCNT) ; o 0x01,(LSTDRB) ; Printer E = centronics parallel printer (LSTCNT) ; ;* Driver Patch Points ; ETXBR = 0x0E B; ETX/ACK driver: Protocol = none, Baud rate = 9600 ETXLEN = 0x8C -; # fill characters for ETX (140) ETXSEQ = 3 / ; Length of ETX escape sequence ETXFF = 0x0C (; ^L Formfeed for ETX/ACK printer ; CN(F TFF = 0x0C ; ^L Formfeed for centronics parallel printer ; ;* Channel Patch Points ; ; The patch points for Channels 2 and 3 are commented out and are meant to ; serve as an example in case you need to add more drivers. ; ; Channel 1, in the default config/uration, is a CTS printer ; SDCB1+0x0F = 0x6E 3; CTS, Input Disabled, 9600 baud SDCB1+0x10 = 0x64 @; DTR high, 8 bits-per-char, protocol enabled SDCB1+0x16 = 0x0C 0; ^L End-of-print character = Formfeed SDCB1+0x(Q19 = (0x0005) ; Input buffer size 5 characters SDCB1+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 2, in the example, is an XON printer ; ;SDCB2+0x0F = 0x1E ; XON, Input Enabled, 9600 baud ;SDCB2+0x10 = 0x64 ; DTR high, 8 bits-per-char, protocol enabled ;SDCB2+0x16 = 0x0C ; ^L End-of-print character = Formfeed ;SDCB2+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB2+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 3, in the example, i(Vis an ETX/ACK printer ; ;SDCB3+0x0F = 0x0E ; No protocol, Input Enabled, 9600 baud ;SDCB3+0x10 = 0x60 ; DTR high, 8 bits-per-char, protocol disabled ;SDCB3+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB3+0x2F = (0x0050) ; Outp ut buffer size = 80. bytes ; ;&== ; SPOOLING ;&== ; PRTMOD = 1  ; Default print( mode = print spooled QUEPTR = 1 7 ; Default Printer/Queue is Printer/Queue A EOPCHR = 0 b ; A "null" in the print stream will terminate printing. ; ;* Dispatch Table ; DSPPAT = 0x01 ( ; Printer A will be fed from Queue A ;  0x02 9 ; If you have a second printer, assign Queue B to it. ;  0x03 8 ; If you have a third printer, assign Queue C to it. ;  0x04 C ; If you have a fourth printer, assign Queue D to it. ; ; the (xrest of the printers feed from Queue A ; ;* Queue Assignment Table ; QUEAST = 0x00,(0x0000) ; Queue A is local  A0xFF,(0x0000) ; Terminate the table with an "undefined" queue ; & 0x00,(0x0000) ; Queue B is local ; & 0x00,(0x0000) ; Queue C is local ; 5 0x00,(0x0000) ; Queue D is local ; SPLDRV = 0xFF *; Default Spool Drive is system disk ; ;&== ; PHYSICAL CONFIGUR(߽ATION ;&== ; ;* Memory - choose the values of RAMBUL and TRKBUF according to the amount ; of memory in your system. All values are paragraph (segment) values. ; ; If you wish to have a RAM disk, choose the sub-set for your ; memory size and RAM disk size. Note that RAM disk is not supported ; on masters with less than 512k bytes of memory ; ; SET ONE - for 256K bytes ; RAMBUL = (0x33C0) ; Top of TPA (No R(ZAM disk recommended) TRKBUF = (0x3C00) ; Floppy Track Buffer BUFBAS = (0x3400) ; Start of External Buffer Area ; ; SET TWO - for 512K bytes ; ;RAMBUL = (0x73C0) ; Top of TPA with no RAM disk ;TRKBUF = (0x7C00) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0x7400) ; Start of External Buffer Area with no RAM disk ; ;RAMBUL = (0x53C0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0x5C00) ; Floppy Track Buffer with 128k RAM disk ;BUFBAS = (0x5400) ( ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0x6000) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0x33C0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0x3C00) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0x3400) ; Start of External Buffer Area with 256k RAM disk ;RDBAS = (0x4000) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk )l)cdGYV@3;Zx0N CRTC0=?-;Zx0Nm         ( k O  [ QDD&EEEEEEEEDlHHGHfHHGHEEEEFSCC0)FdGEd PEQ Q P*g g SCC1)FdGEnd E) P D@   P   rt~SK>)0LKKJ2I:IAIHIIACE0IJ$I` 5 5 %K K ACE1IJ$I` x x % ACE2IJ$I`  % ACE3IJ$I`  %  ACE4IJ$I`` A A %W W ACE5IJ$Ih`  )e% ACE6IJ$Ip`  % ACE7IJ$Ix`  ) ;@+&   ` )M< ~PPmQmQjRIRUTSSS4TUUO1U;POM$s M$s M$s s Ps (s (s @ A$B(CI 2J Hj HK) :*P &:G: 6 ( 5t .@F80 F81 F82 0F83 UF50 RF51 wF52 F53   ||zVOO)VOO (O P_(K(J (jPN Pn(I (M P]>^e ~hM4M 4MMM =4MK M1 M           $- &/ (1!*3#, %. '0 )2"+     )qI,     DW1100Z  )t(WWX,X^XiX^XX\\=]!\\\\\ !\\TAPEFCNSF$tËG#H>V G>F)P>f&X>F's>F&>V>F&>V>VB>~-G>F/S^[G>F$< t>~-G>F/S^g[>F$< t;t t- )G$> F%G=tO>F"0:GG u0>~- 6>F/zS^[>F$>~->F/Y>F2t>FGt @G GñG>N  >F >f >F >V>V>V)) ;&== ; ; OLDSPOOL.GEN TurboDOS v1.43+ x 03 Feb. 1987 ; ; These modules support a single user spooling system on the Model ; 1230 processor. ; CNFTBL ` ; Configuration tables STDSPOOL ; Modules for a single-user system with spooling CPMSUP ! ; CP/M Function Support ;MPMSUP ; MP/M Function Support ;QUEMGR '; MP/M queuing function support USRSOM  ; User Sign-On Mess )) be echoed when ATNCHR is detected ATNCHR = 0x00 ; Halt process ECOCHR = 0x10 ; The sequence ATNCHR-ECOCHR will echo screen output to  ; to the current list device until ATNCHR-ECOCHR is retyped PRTCHR = 0x0C ; The sequence ATNCHR-PRTCHR will enqueue the print job RESCHR = 0x1E ; RESCHR, after ATNCHR, will resume process CLBLEN = 0x9D ; Longest legal command line = 157 bytes CLPCgHR = ">" ; Prompt character, displayed when OS ready for command CLSCHR = "\\" ; Command separator,)[( for multiple commands on one line ; ;&== ; LOGON ;&== ; AUTUSR = 0x80 ; Priviledged user 0 logon COLDFN = 0,"COLDSTRT","AUT" ; Drive # & file name for cold-start autoload WARMFN = 0,"WARMSTRT","AUT" ; Drive # & file name for warm-start autoload LDCOLD = 0xFF 1 ; Enable cold-start autoload LDWARM = 0xFF )] +; Enable warm-start autoload LOGUSR = 0x1E l ; User logoff number = 30 USRSOM = 0x0D,0x0A,"L/F Technologies, TurboDOS-16 1.43+16d.01 (STDSPOOL)$" ; ;&== ; CONSOLE ;&== ; ; The patch points below are set for a console on Channel 0. If your ; console is on Channel 1, you must change "SDCB0" to "SDCB1" as well ) ; as the CONAST channel assignment. Each option listed here sets the ; baud rate to 9600. To change the baud rate, adjust the 2nd digit of ; CONBR according to the tables in Turbogen. ; Some commonly used rates are: ; ; x7 = 1200 baud xE = 9600 baud xF = 19200 baud ; CONAST = 0,(CONDRA) ; Console Channel # & driver entry point ; ; Choose the next two parameters if you have a "no protocol" terminal. ; CONBR = 0x8E ; Console = 9600 baud, no proto)col SDCB0+0x10 = 0x64 ; DTR high, bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have a CTS terminal. ; ;CONBR = 0xCE ; Console = 9600 baud, CTS ;SDCB0+0x10 = 0x64 ; DTR high, bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have an XON/XOFF terminal. ; ;CONBR = 0x9E ; Console = 9600 baud, XON/XOFF ;SDCB0+0x10 = 0x60 ; DTR high, bits-per-char = 8, protocol enabled ; ;* Buffer Parameters ; SD)xqCB0+0x19 = (0x0050) ; Input buffer size = 80. bytes SDCB0+0x2F = (0x0050) ; Output buffer size = 80. bytes SDCB0+0x1D = (0x0005) ; "Start Receive" threshold: send XON or raise CTS SDCB0+0x1F = (0x0045) ; "Stop Receive" threshold: send XOFF or drop CTS ; ;&== ; PRINTERS ;&==< ; ; LFT supports 3 configurations of serial devices. Ea)ch of ; these configurations starts with the two serial ports on the Model 1230 ; board (Channels 0 and 1). Usually, Channel 0 is the terminal. The other ; configurations depend upon your mixture of Serial Boards. ; ; If you have: % Set NMBSER to: ; ; A. 1230 only:  2 serial devices: 2 ; B. 1230 + 1250:  8 serial devices: 28 ; C. 1230 + 1250 + 1250: 14 serial devices:  14 ; ;* Number of Se)rial Channels to be serviced ; ; Set NMBSER equal to the number of channels indicated by the configuration ; you chose above. ; NMBSER = 2 ; Configuration A ; ; ;* Printer Assignment Table: per order in STDSPOOL.GEN ; ; This table assigns a driver to each Channel in your configuration. Which ; driver is "LSTDRA" depends upon which one is listed first in STDSPOOL.GEN. ; ; The assi\gnments for Channels 2 and 3 are commented out and are meant to ; serve as an example in c) ase you need to add more drivers. ; To use two parallel printers, use the second set of instructions. ; PTRAST = 0x01,(SERIAL) ; Printer A = Channel 1, CTS printer  B0xFF,(0000) ;Terminate the table with an "undefined" printer ; 4 0x02,(SERIAL) ; Printer B = Channel 2, XON/XOFF ; 3 0x03,(LSTDRA) ; Printer C = Channel 3, ETX/ACK ; 0x11,(LSTDRB) ; Printer D = centronics parallel printer (LSTCNT) ; ; To use two parallel printers, enable the following two patches. **(age area, filled by OLDSPOOL.PAR NIT186 ? ; Cold-start initialization, particularly hardware init XTISR /; Interrupt Sorter for Model 1230 board MEMTBL ' ; TurboDOS memory fragment tables RTC ; Real-time-clock driver CONSOL  ; Terminal handler ;SUBMIT 5; To emulate CP/M processing of $$$.SUB files USRSUP / ; To handle more than one USRFCN module PATCH ; Software 2000 Patch Area ; ;===*=== ; ; SERIAL I/O CONTROLLERS ; If you don't have any Model 630 or Model 480 I/O boards, choose SET ONE. ; With SET ONE, you can choose CONSOL and 1 printer. ; If you have one or more I/O boards, choose SET TWO. With SET TWO, you ; can choose as- many devices as you have serial ports. ; ;&== ; ; Set One ; ;XS3040 >; I/O driver for 1230 SCC ports only ; ; Set Two ; XTSER *X - ; Serial I/O handler: must be present XTSCC +; Serial driver for Model 1230 ports XTACE ?; Serial driver for Model 631 and 480 boards - "Asynchronous ; ; Communications Elements" ; ;&== ; ; PRINTER SELECTION ; How many printers you can choose depends upon how many serial ports you ; have available. Which drivers you choose depends upon your printers. ; ; ==*{== ; LSTETX ! ; ETX/ACK Serial Printer LSTIMS + ; Centronics parallel printer driver ; ;&== ; ; DISKS ; ; LFT supports three standard configurations: ; ; A. Floppies ; B. DMA winchesters (1100 controller). ; C. RAM disk ; ; Choose one of the sets below accordingly. ; ; NOTE: The order of the driver modules determines the n* ame of the ; =driver entry point. For example, if you have Floppies and ; `t 9`s` r)+` `uH` û`)G`\U \QDOÉ` )s` ` ` ``tW` @@)t/r9`r``ڋ`t`= r GË` BB$0Ë` ` BB)Ӱr;`r ` CCW0Ë\U`W``t5` 9tG;` tWRZ`WR ZW뺋*````tHH;` tG` 0ý "uVý  uaý 3tBý  *tODS  tt`)G`j ڰDODS tDOËG+GG)GAOڋ+G7wG)OS`P`ڻ` X`[Gڻ`>  9DS TUT]`> Gt ;r9r DOà`PG` >`ju(`> Gt`:Gs SQ LY[G X` o rKOGG`7wG)OSڻ`> ^[G *J`P`ڻ` BX`DOX`û`> $` ```RQ` YZù (C` t/`:Gu2G;tG;u  )ËGGá`u`⻋`t`GڋOډOU ]``f`  uډ wr0G+Gs/>`t؀>``u;`s``⺠``t>``u` û`>`f `:Gs rtËG t)ڋ+r PGQڋ)Ys ;Gr9X *ڕ\UD]`fݹ ``COMSUBOriginBUnitDataCodeCONOUTSYSDATUndDataUndCodeTSTUND DEXLAT0SHL7BX7DECOUTuUNLINKLNKENDLNKBEGDMSDMSBXUPRCASCALCBVLDIRLDDRGETSDS!00`ù Cty$8u ;uCC QYô '    d ĺ )sӄut 0PS[XËGډGË_OW ډO[ * .CtS[`+ t`DSPCHROriginBUnitVDataICodeXTNTRYDEALOCALLOCLNKENDUNLINKLNKBEG GETSDSTICCNTRDYSPHCTPFCN/CRPROC=GETWSBsSMFCNySNDMSGSIGNALRMFCNRCVMSGWAITLNKPOLISRXITSETDRFDISDSPDSPIFRENADSPDPFCNDELAYRESUMEDLYTIC6GETTOSDSETDDF"a c T` TUt \Q "DOñ`U@`T +P` [ SR ]ZYu5QS ]C[`TGN`TYOD [ [ GF_HW3R` [0ËTQ\US[ \U \Q q_û`PV `U@u  D7@u DL` b %^Xπd7D7@tL7L7@  D7ud7À`U`UuÀ&`U`x0\Ut\8` \L`U@D:\T@lB|DdFTHDJ؎м`T&`U r`` t7W[`U u# ƻ` \Lx` `U `t ƎDJTHdF|DlBT@+ L>\`t;`sx`ruWuWt]`\G`Z`Z 5tS[t `\WuW9s S `ZG`\ H= uʉW[ ^>`t E`3u`/`*`,`,s0`2`-`3Dj`*a` t7O-S po>au ؋` Q ` EY[ Ìػ`*.`3 0`3; :`* Gt Q`Z W@u¹ `\S [Y DO= ta>`1rZ`'tS`'`)`!u? u: `*t.SP WX G[GS_&[`DlDjQrVtjtl PDj llQ XUHP$ X@Q 3 Ƅ @DlY]X DlDjU ,|a*]Y ú` $`*`^`Z9NONFILOriginBUnitDataCodeCOMPATCLSAFPFREDRVCKTASTXTNTRYUnit Origin USRFCNCPMVERROSFCN RVNFCNDT1FCN`DT2FCNgDT3FCNSRCFCNCLOFCNROUFCNEXTFCN1 ` `DU`DO\_Ë\UD]&R&G &G [ * P$X$t DO &Gñ ,g * ؋\UD]& &G &G, s ËDU= t`á`DOÀ DS0 t DTDU`DQ ` Ë\QLjTUDl TULS\QDOCONMGROriginBUnitDataCodeINPLNATNCHRCKDOSTDOCONIATNBELRESCHR ABTCHR PRTCHR ECOCHR EOPFCN ERRXITLSTOUTCONASTTSTUNDCOLCNTCIFCNCONIN#ECHO COFCNaCONOUTXRCIFCN_RCOFCNeDCFCNCONSTP,BFCNCIBFCNCSFCNSRTFCNPBCFCNwXFRCDCONINICKATTNmCONOIqCONSOuCONSI$ < s< t < t< t<uP XDOÊDU< s(< t < u$``$*`Q Y`  DOÊLU DUttt t ot mDOË\UD]&C:`t S [Ë\UD] > DOË\Ut`à`DOË\UD]&O&G&&CIQS 9[Yò :`t & ut` t:`t `,t : :`t!: `t: `t: `uڀ  u   tQY Dgtȴ` Ê/_tCONTBLOriginBUnit DataCONDRAATNCHRRESCHRABTCHRECOCHRPRTCHRCONASTATNBEL `DOMGROriginBUnit DataCodeXCNTRYSETCBFUNLINKSAVCLBLDIRCLRCLB LNKBEG ALLOC DEALOCDOCONIADFFCN~CKDOST, a!`uFCtjtl\j\lTn R`DnƄ `ZTn DlDj`tG*Ê< t<u t `` `  ËDUu Dn`u``t `` Y YuC` ) Ju4` ڌ݋\UD] `G G G$Sڱ[O$t DOÃ`  # ft `S 1[   `t  `t:  -H-rt of External Buffer Area with 128k RAM disk ;RDBAS = (0x6000) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0x33C0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0x3C00) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0x3400) ; Start of External Buffer Area with 256k RAM disk ;RDBAS = (0x4000) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ;- SET THREE - for 1024K bytes (one megabyte) ; ;RAMBUL = (0xEFC0) ; Top of TPA with no RAM disk ;TRKBUF = (0xF800) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0xF000) ; Start of External Buffer Area with no RAM disk ; ;RAMBUL = (0xCFC0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0xD800) ; Floppy Track Buffer with 128k RAM disk ;BUFBAS = (0xD000) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0xDC00) ; Base of RAM disk with 128k RAM disk- ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0xAFC0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0xB800) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0xB000) ; Start of External Buffer Area with 256k RAM disk ;RDBAS = (0xBC00) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ;RAMBUL = (0x8FC0) ; Top of TPA with 384k RAM disk ;TRKBUF = (0x9800) ; Floppy Track Buffer with -384k RAM disk ;BUFBAS = (0x9000) ; Start of External Buffer Area with 384k RAM disk ;RDBAS = (0x9C00) ; Base of RAM disk with 384k RAM disk ;RDLEN = (0x6000) ; Size of RAM disk with 384k RAM disk ; ;RAMBUL = (0x6FC0) ; Top of TPA with 512k RAM disk ;TRKBUF = (0x7800) ; Floppy Track Buffer with 512k RAM disk ;BUFBAS = (0x7000) ; Start of External Buffer Area with 512k RAM disk ;RDBAS = (0x7C00) ; Base of RAM disk with 512k RAM disk ;RDLEN = (0x8000) -k ; Size of RAM disk with 512k RAM disk ; ; ; ROM starts at 0xFC000, which is the effective end of memory ; ; IF YOU PLAN TO USE TURBOGEN, DO NOT CHANGE OSMLEN & OSMTOP ; OSMLEN = (0x1000) E; Reserved memory for buffers and working storage OSMTOP = (0x0000) ; Absolute top paragraph ; ;&== ; DISKS ;&== ; ; If you change BUF-qSIZ & NMBUFS, change RAMBUL, TRKBUF, BUFBAS, and BUFLEN ; to reflect the new buffer requirements ; BUFSIZ = 6 * ; Disk buffer size = 8K bytes NMBUFS = 4 ? ; # disk buffers allocated at cold-start (4) BUFLEN = (0x800) 0 ; Number of paragraphs in BUFBAS ; SRT431 = 3 5 ; 6 msec step rate for Shugart 5" drives SRT401 = 8 ; 8 msec step rate for Shugart 8" drives ; ; Disk Assignment Table ; DSKAST = 0x00,(DSKDRA) ; Drive A = floppies -& 0x01,(DSKDRA) ; B  0x02,(DSKDRA) ; C  0x03,(DSKDRA) ; D  0x04,(DSKDRA) ; E  0x05,(DSKDRA) ; F  0x06,(DSKDRA) ; G  0x07,(DSKDRA) ; H ; ; Choose one of the next two Sets depending upon whether you have a ; Winchester controller. ; ; SET ONE: choose this set if you do not have a winchester. ; 8 0xFF,(0x0000) ; Drive I is not in the system ; -< 0xFF,(0x0000) ; Drive J is not in the system ; 6 0xFF,(0x0000) ; Drive K is not in the system ; 6 0xFF,(0x0000) ; Drive L is not in the system ; 6 0xFF,(0x0000) ; Drive M is not in the system ; 6 0xFF,(0x0000) ; Drive N is not in the system ; 6 0xFF,(0x0000) ; Drive O is not in the system ; 0xFF,(0x0000) ; Drive P is not in the system ; ; SET TWO: choose this set if you have a 1100 DMA winchester controller. ; -  1 0x00,(DSKDRB) ; Drive I = DMA winchester  0x01,(DSKDRB) ; J  0x02,(DSKDRB) ; K  0x03,(DSKDRB) ; L  0x04,(DSKDRB) ; M  0x05,(DSKDRB) ; N  0x06,(DSKDRB) ; O  0x07,(DSKDRB) ; P ; ; If using a TurboDOS RAM Disk, the RAM Disk must be mapped into the Disk ; Assignment Table. ; ; 0x00,(DSKDRC) ; Substitute this value into the drive --5[ZYË\K9sË\o^S  Pӹ  BCC)rB)s S\o qZX$űt ut l[^\oÈuRS&uCC&[Z u0QRS\UCD] $&C$8 u+`2 Sڊ&*$u BC[0 B[ü[ZY Ou4 r/  r'  CCCCC C  WDo Q Ys  urtQ DoY u uTJ D$ (Ј A ut ;T 0u Ps( -,`t)r(WSZڄuWO QR [ZYY`(u`x 5`D&u !``ՊD( ȈD0D( D( tuv u  D0u/D/@u)\(S` 0)Ӊ\(r {[\(t {y5``9t T1 A 2L` \1 U y\1W` 9Ӊu t w  -@t  t kt  ! l-G mtD t \1G_t0D&t\+D-T+l-D&tڕ D&t @KD0:rD( D0D(   CD(CD)CD*C`D/tD0C' :DU$` DV<s` `&`DQÊDU tÊDU lV t  Ӊ`` t S [u ` 9trӉ\1t:Ouŀu  uP xG u @t2Q %t uY   @ Y@tQ gY u t w\1 ttAŀt<t$`<`u/Q `ˋt-SQ Y[Du `Y` ` 9t Ӏ'߉tuË`Q Yŀt Q Y0û` ` 09tS [t\1Ãd' D'V D':uFC0^d'uD0:r u D/tD À'  tJD$`:Ds u tu % _ VCDF^\1GD"GD 0 / \1 `\1`   uú    \1ÊD- ' ` ` 9DSKMGROriginBUnit2Data?CodeDSKASTLDIRSHL7BXDSKERRERRXITTSTUNDDSTPTDSKNITBPDAFCNSELDRVDSKMGRGETXDR `1 QS`ˉ``` ڊ:uBCB['KYyB\U D] t6T DD DOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r u u ;ËL$IDxAL\$\TDd ..a position ; ; you wish the RAM Disk to reside. ; ; NOTE: When using the TurboDOS RAM disk, DO NOT use Turbogen to modify ; -the memory, buffer, or disk parameters. ; ;&== ; MISCELLANEOUS ;&== ; COMPAT = 0xB0 B; File Access: Permissive, global-write, mixed mode CPMVER = 0x31 ; CP/M BDOS version returned by.e C-fnc 12 SRHDRV = 0xFF >; Search drive for command files = system disk JDATE = 0x3639 ' ; Cold-start date = Jan 01, 1986 ; ;&== ; PATCHES ;&== ; ; Patch 1.43-01 ; ; The following patch is applicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fcn 15 .Iopening the ; files $.DIR or $.DSK when FCB byte 32 is FF. The ; 'PATCH' module must be included during system generation. ; OPNFIL + 0x4A = [PATCH] PATCH = 0xE8, [CKSPFN], 0xB0, 0x00, 0x74, 0x03, 0xE9, [OCECOM],  ,0x83, 0xC4, 0x02, 0xE9, [OPNFIL + 0x59] ; 8 ;&== ; PRTMOD = 1  ; Default printmode .G%XEUVa&...@e.U:_.vT,U..%*    ...... ..f..( ) * .+ .\ ^ R .v w  .&z L  6 y B ,{n  .h. <0..&.XE.& ..&τt2u&/t6u.t.uxVC.B<^1.u.&.XE.&Dg0<4$n"cG !BtRS5[+[!.oBt.ru.u؎ڱ3຀.U. .0\, vA    : @w utVtXtNtP<t,tBt[TJtSL? - [>A? (Retry, <t .?Ignore, "?Abort) 0t00Pu0.cX?.(t$.(RCCڊCCCtS[ڌ،f>ZT륀>tbR 5[Cu2Cu!< u)< u CCMCD/t-&, t@ ;@uD$?t*tD/t tTi%rڈCځrsSCr[Khh ػD.\== .ex/t -Ks N u# tu±>u  0DS\UD]&&_SZSDU&< uCڻSP[rCtu)r8t"<.tE<:tIr!t4uru)< u r tJZS،m;[[\Oð(tC<0r<:s<,0ĠtQ. 7rrrrr< s Yt$Yu4 G uϰ' & &'9t M:t& YLn   P xXt\\L0 0à :ruKK :ru CCC :rÊ KK CCC  &&CC&7Lj$$ňŜ $ C&C&/C&;<. rBR=>rFu?uZTU\\QDDSDDO<DDQDDUDDSDDOÊDU@A` DVt'RSDUB[ZuLVu !Ӊ`ÈDO Ӊ`ðtȈSDUDDCtD[É\Q<ErFrGHDO<G Djrt Eu{,7 DO;tjn&GP&wSAQYDOu/N [&GX&GDjSr+tt =u>,;,u 4, u*,DOÈDO&&&# +t&C&$K&C&C&$&C$&:rB&Ȉ&:u CC&*t QLYuQ+YP&/CC&0J&6&ÁDjw DOuo u0LnQfu iut& tFDnt=Dn>u4AG uϰ'& &'*tM*t& YLnPxXt\\L00Ã:ruKK:ru CCC:r/ÊKKCCC3&&CC&7Lj$ň$ňŜ$C&C&/C&)1 n rBR ^ rFu uZTU\\QDDSDDODDQDDUDDSDDOÊDU|G*hDVt'RSDU|)[ZuLVu !ӉhÈDO ӉhðtȈSDUDDE)t[É\QvY rD  r DOY J`?`@`A`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[` \`]`^`_```a`b`c`d`e` f`g`h`i`j`k`l    damno u    tOtQtS/<tUtWtYt[t]t_ i <D_D]D[DYDWDUDSDQDO t ËdaDO DetPpD_t]l[|YtWTULS\QDO t^qVrƉ\QLSTUDW|Yl[D]D_DO srKDS u`<2%GETAVL?GETNAB@GETXDRACALCBVBCKOPNDCCKDRVLDDSKMGRECKDROFGETLSAGZERODNHALVNITIADVDNOJCLSFPKCRFCBPLGETDLSMFNDNDENFNDDDEROVECTOFFCN OPNFILCFFCNCLSFIL SFFFCNSNFFCNDFFCNDELFILCRSFFCNWSFFCNMFFCNMAKFILRFFCN CQMCOMSFAFCNHCKLEXTcRDRANDhRRFFCNWRRANDWRFFCNCKLERRCFSFCN/`CFSFILSRRFCNKLFFCNNRAVFCNRDPFCNSRSFCN RDMFCN& RDDFCN  DOÈ u|t# PtKufu:\UD]&G t- u# &u u4 G &0Ê $<t tDnt& u P uXDOuL &@tCS [&&o&guŀt"QYt DnP tDn  XDn0ËDUDz -t /yËDzDUD|DoD~Dq uDOS\UD]&$t)r(WSQZڄ0uWO QR[ZYY(ux5D&uI!ՊD( ȈD0D( D(tuvuD0u/D/@u)\(S0)Ӊ\(r{[\(t {y59t T1A2L\1Uy\1W9Ӊutw-@ttkt!lmtDt\1G_t0D&t\+D-T+l-D&tڕD&t@KD0:rD( D0D(CD(CD)CD*CD/tD0C':DU$DV<s&DQÊDUtÊDUvlVt  Ӊ0t S[u9trӉ\1t:Ouŀu uPxGu@t2Q%tuY@ Y@tQgY utw\1ttAŀt<t$`<`u/QˋtSQY[DujY9t Ӏ'߉tuË%QYŀt QY0û09tS [t\1Ãd'D'VD':uFC0^d'uD0:r uD/tDmÀ'XtJD$:Dsu tu%_VCDF^\1GD"GD 0/\1\10  uú   \1ÊD')9QSˉڊ:uBCB['KYyË\UD]t6TDDDOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r uu;ËL$IDxAL\$\TDdx\ǀuڹA)syIAx )sڋ\ˋL D"D L \TڋLˇڋ\)s,Sˉ\Q ZuH\ LډӉ\7\C뻊D\T0)s؎otDttDx\ÊD$¶Ӌu 0=0tRD]&uS U [tDO&C` 8s`BڈC` S[R[ 0` d st  ]tO et tC Q Yu-S`C` CtCڋ` ،Z`0``  tË``Ë` à`:u`AUTLODOriginBUnit?DataCodeCKDOSTCKCBSTLDIROCNTRYLDCOLDLDWARMCOLDFNWARMFNCOLDLDWARMLDALDFCNCO0LDSTRTAUTWARMSTRTAUT`t ` @t`@à`&`@u)`u uu`t` u`0ú`،ݹ `!`'`t`;`; @ÊDUu`À&`SGLUSROriginBUnitDataoCodeCKDOSTCKCBSTDSPINPDSPFCBCALCBVDSKAST OTNTRYWSRESCIRES`ut -` ` sS` ˋ ![y0Ӻ `S`[uRPs S [XZyAUTLOGOriginBUnitDataCodeCINTRYAUTUSRAUTLOG` t ʶ0DSPOOLOriginBUnitNDataCodeALLOCCRPROCSETDDFOTNTRYOCNTRYDSPPAT RCVMSG DEALOC DELAY GETTOS WSRESCALCBVXFRLDSNDMSGGETFDDSKASTLDIRPTRASTQUEASTDSPINPDSPFCBDSPNIT+0&SRDFCNQPFFCN " D cFFJJ  uQ S`Q[Y u*QS  S0CC ڈC7CC7CZ[WYyQ`Uڱ3 y `$ʻ` ˊt S + [t0ӈ  G tS  !ÊCDnE[ s`   R  [t !CC tAt t.E W {  t `0 {uH  KR!Zu !uCuC]  $R F ZEt ĺ   - 7t ` ˈ/ññ  Ӊ` !Ӊ` %`  Ӊ`" !Ӊ`"È ! Ê`"ù QCS  [Yò DT$DT { tDOËTU`4˃u tt$S SDOÈDPFCN?AMFCN@DMFCNASMFCNBRMFCNCSESFCNDSERFCNESDTFCNFRDTFCNGRDMFCNHROUFCNISCFFCNJLOGFCNKLFFCNLADFFCNMALDFCNNSCLFCNORAVFCNPRDPFCNQSRSFCNRPDAFCNSSBPFCNTRBPFCNULFDFCNVFFBFCNWSRPFCNXEOPFCNYSRDFCNZQPFFCN[FLBFCN\RCFCN]CCSFCN^CCIFCN_CCOFCN0 *`SCBFCNaRCBFCNbSMCFCNcRMCFCNdEXTFCNeRDDFCNfTOFFCNgTMFFCNhTLRFCNiTFRFCNjSFLFCNkRFLFCN;lCodemDISDSPnSETDR1oCKATTNpENADSPqGETSDSrGETWSBsNETREQtPFNFCNuDT3FCNvMPMFCNwTSTUNDlOCNTRY lOTNTRY#lXCNTRY0lXTNTRYlERRXIT``````` ` ` ` ` ```````````````` ``` `! 1#1{%S*uDtlt;lsxlruWuWt]G5tS:[tWuW9sS1CGH=uʉW[ ^>ltE.uDjnt7O-Spo>nu؋nQnEY[ Ìػ.0;:Gt QW@u¹S[YyDO=ta>1rZtSp!݄u?u: t.SPWXG[GS_&[pݏDlDjQrVtjtlPDjllQXUHP$X@Q3Ƅ@DlY]XDlDjU n]Yúp6݄$91b_.DUDO\_Ë\UD]&R&G&G[* P$X$t DO&Gñ ܁*؋\UD]&&G&G, s ËDU=táDOÀDS0t DTDUBDQË\QLjTUDlTULS\QDO< s< t < t< t<uPXDOÊDU< s(< t < u$$*Q Y DOÊLUDUtttt otmDOË\UD]&C:t S[Ë\UD]>DOË\UtàDOË\UD]&O&G&&CIQS9[Yò :t1q&ut`t:tt::t!:t:t:uڀuWtQY DgtȴÊ/_ tËuFCtjtl\j\lTnRDnƄLZTnDlDjtG*Ê< t<ut T԰ ËDUuDnPu`t `YYuC)Ju4ڌ݋\UD] G G G$Sڱ[O$tDOÃL #ftS1[  t t:5$tS1bDnPDnڱXDn[ËË)&/C&SC0P<t<< s<t4< t5<t<<t8XP8s&CXP< s@Q^VYNX[&uZXtPK&< sXPRSQRH  ZY[SQ'Y[SQY[Ë\UD]&O&G&IQ&CS[YË\UDT tLQS[Yt <sDhftfTUt \Q"DOñvӀ@Pp[ SR]ZYu5QS]C[GNYOD[[GF_HW3R1p[0ËTQ\US[\U\Qq_û|PV@uD7@u DLpb%^Xπd7D7@tL7L7@D7ud7ÀuÀ&px0\Ut\8v\L@D:\T@lB|DdFTHDJ؎м&r||t7W[ u#ƻp\Lxp ptƎDJTHdF|DlBT@L>\t 9sr)+yuHûy)GË\U\QDOÉ)stW@@)t/r9rڋt=r GËBB$20ËBB)Ӱr;r CCW0Ë\UWt59tG;tWRZWRZW뺋tHH;tG0ý"uVýuaý3tBý*tODStt)G,ڰDODStDOËG+GG)GAOڋ+G7wG)OSPڻX 11i*WARMSTCLRCDCcTurboDOS 1.43, Copyright 1986, Software 2000, Inc. $($/$)$( `0.`.&`.`.&` .`.&` τt2ut6u .` t.`uV C.` ^1.`u.&`.`.&` Dg 0 `` $n`c G  tRS` 5[ ` +[ ` ! ` t1- . ```u.` `` u؎ڱ3 .` U.` .` 0 \,`` :@u tVtXtNtP<t,tBt``t b`R 5[CuC`  ` ` u ``'< u `/< u CCMCD`5t`3 `,`2`& t `F`&; @u ` ` `J   $ ?t *t`J  /t t`Z `o` % rڈCځ`r  sSC`r[K`n`n ػ`J.` \  `&x``5t 1`3 K`` s  `N`&u#`t` u±>`u  0DS \UD]&&_S Z` SDU &< uCڻ`S P[  1 rCtu) r8t"<.tE<:tI`  r!t4u ru)< u r tJ ZS` ،[[ \Oð(t`C<0r<:s<,0Ġ`%t`%Q`#rrrrr< s `#Yt$Y,u(Gt:Gs SQLY[GXorKOGG7wG)OSڻ^[GPڻBXDOXû$xyRQYZù(Ct/:Gu2G;tG;u)ËGGáu⻋tGڋOډOU](uډwr0G+Gs/>t؀>u;s⺠t>uû(2!:Gs rtËG t)ڋ+r PGQڋ)Ys ;Gr9X ڕ\UD](ݹ00.ùCty$8u ;uCCQYô'd ĺ)sӄut 0PS[XËGډGË_OWډO[.CtSH[8G. 1Ҏ¿GȫێډPPۿZXЫLtGȫ(%؎.F4&6.F&4`.F$$8u08"a4&6VW.F؎>Lt 12ء=5uâRV1ػ =HO2_^.F&.F&`~~<u4>u-u>u>u  PE8~ *<~&u>uuȍ עá-6 2K6BBFÈ$ 0P%XË& %& u>t@1H1ȣfດúu8shiju ĺfau<t< >u Gà u#<u<u,t*t& RQ q t YQaYZ 8h@ .7...%... .Ät.Qڻ! ?t P X Cڌ،jYÄt* 8ذrBS! ?t :r o*G[2} NjGuutu@t u  @ G3 O 86t gG@tW u OG tW 0FnÍ W $?t$0 g ÀO Í  W G u$Gt*Gt$:Gu2O:GugG uGt:uWW%W#G!!Gt7;r2OG@W tİG3$GttG;t)g %;r%G!Gt S_'[gÍ  GuG7u O (W (w;;w-rw1w;O7Gt S_=[gËW g Í  W tgG t OW Í  W @t GGt GG GG@0G 0 ÈÈOÈOËW tOgtO gߨ tO@g@tOgGËW 0Gt  10Rȫ8S_L2 [G#G%GGGS_/3[G9G;G1G/G-W u utB0G%6 ƃJG t Gt Gt B0Gt G@t G u gG@t uOBO .F & .F&( ` z t0W tC % "a & ϋW $t)t GGt GG GG@ËW G u$Gt*Gt$:GuO:GugG uGt:uWW%W#G!!Gt;;r6OG@tċW $GtċW  tG;t- 2/2;&== ; ; STDSPOOL.GEN TurboDOS v1.43+ v03 Feb 1987 ; ; These modules support a single user spooling system on the Model ; 1230 processor. ; CNFTBL ` ; Configuration tables STDSPOOL ; Modules for a single-user system with spooling CPMSUP ! ; CP/M Function Support ;MPMSUP ; MP/M Function Support ;QUEMGR '; MP/M queuing function support USRSOM  ; User Sign-On Messag2p&e area, filled by STDSPOOL.PAR NIT186 ? ; Cold-start initialization, particularly hardware init XTISR /; Interrupt Sorter for Model 1230 board MEMTBL ' ; TurboDOS memory fragment tables RTC ; Real-time-clock driver CONSOL  ; Terminal handler ;SUBMIT 5; To emulate CP/M processing of $$$.SUB files USRSUP / ; To handle more than one USRFCN module PATCH ; Software 2000 Patch Area ; ;===2=== ; ; SERIAL I/O CONTROLLERS ; If you don't have any Model 1250 I/O boards, choose SET ONE. ; With SET ONE, you can choose CONSOL and 1 printer. ; If you have one or more I/O boards, choose SET TWO. With SET TWO, you ; can choose as many device!s as you have serial ports. ; ;&== ; ; Set One ; ;XS3040 =; I/O driver for 1230 SCC ports only ; ; Set Two ; XTSER ; Ser2g'ial I/O handler: must be present XTSCC -; Serial driver for Model 1230 ports XTS1250 *; Serial driver for Model 1250 ports ; ;&== ; ; PRINTER SELECTION ; How many printers you can choose depends upon how many serial ports you ; have available. Which drivers you choose depends upon your printers. ; ;&== ; LSTETX  ; E2TX/ACK Serial Printer LSTCNT + ; Centronics parallel printer driver ; ;&== ; ; DISKS ; ; LFT supports three standard configurations: ; ; A. Floppies ; B. DMA winchesters (1100 controller). ; C. RAM disk ; ; Choose one of the sets below accordingly. ; ; NOTE: The order of the driver modules determines the n ame of the ; 6driver entry point. For example, if you have Floppies2 and ; Ft>VYÍp S36z >x V؎T:UvVӋ?U׹߉֊<r<uVWLn \ D ؉_^n D D =Fu$dDDt(r([SDDGDE tP\;] rH];\s\D] E׈Du0Lt-[S\ ML E<u<@r,@t^VƊ<s&<uPWV| LD n ؾ^_X<rp RjZ^6z >x È uK=Fu@VuD\:D t u^\ ] \ ] LEV[]^]\Ј^؋\ \ 0]mVW>V_^US>x 6z 6z >x []1<r& >Fu ?t3tPX0| GG>f6 >~+GuCN1G>V4S9[u!>V$t?zt7G >F)G >F'GG:Gr*GG@G GG#u~t0tG >F)G >F'gGG:Gr*GG@G EGP)vYOG2O GGYO#?tG u,G u&|u$Gt{uGtGte1Gt GutuG@tFu fO0ggPuGG3t tÀOOlÀuGPG*`t< utG(DG@tCuGt GtgÀgߊG$KF'G >F) jgwGtGG$$:tFGGG0ËO:Os0GtGGtoGtt .tG@*G ÊG$Àg>F >F >:F rYGV>FGر G>FG>F>F/J3ô@>~-3>~- >~-gGGG G$GGu>F/ S^{[>F$t>F u>F  u >F  uX@ uLG>~- dG$GGG->N >F/S^[>f g>F$tËG#H>V G>F)P>f&X>F's>F&>V>F&>V>VB>~-G>F/S^[G>F$< t>~-G>F/S^g[>F$< t;t t- )G$> F%G=tO>F"0:GG u0>~- 6>F/zS^[>F$>~->F/Y>F2t>FGt @G3) GñG>N  >F >f >F >V>V>V>v-0>N/Q+uYY[>V>~00>N2Q&uYY<0JP쨀uXBX0JuB0Q Yð>VtK>V$Vuuш$f>F >F2Ru^ý&>Ftýa>FtVW؎p OPp FX_^Ê<t.<t0<t2<t9<tD8>u3t=ZޠJJK%H #DDD P&IXD sIIDH#DH#DD P&IXD sIIDH#H DDDDDD HDÊH0V6>u^uPSQxBtKuY[XY[XJSQxBu KuY[JË>u!J>uKuZ%JK`0 0WtP#DD؉D 5D 5D#>#r)4*&>XB$uJ3JBt@J>u+ >uJ>uKJu JK0BQ Y020#Ȣ4ouE5)t*02ϡ$+0'>)u=r= r*$00$')GDuFձ u>F չ $@u JuGGÊG$>F GÊGpF Q$ t JuY Y>F C⿰[GÊG$t@>F >Ft@t'Ku!`HuG $ uGú$p<0t $@uJuհ؋G O ȜPЈЋG= v 33` TUt \Q "DOñ`U@`T P` [ SR ]ZYu5QS ]C[`TGN`TYOD [ [ GF_HW3R` [0ËTQ\US[ \U \Q q_û`PV `U@u  D7@u DL` b %^Xπd7D7@tL7L7@  D7ud7À`U`UuÀ&`U`x0\Ut\8` \L`U@D:\T@lB|DdFTHDJ؎м`T&`U r`` t7W[`U u# ƻ` \Lx`3| `U `t ƎDJTHdF|DlBT@L>\`t 9`s` r)+` `uH` û`)G`\U \QDOÉ` )s` ` ` ``tW` @@)t/r9`r``ڋ`t`= r GË` BB$0Ë` ` BB)Ӱr;`r ` CCW0Ë\U`W``t5` 9tG;`3z tWRZ`WR ZW뺋````tHH;` tG` 0ý "uVý  uaý 3tBý  *tODS  tt`)G`j ڰDODS tDOËG+GG)GAOڋ+G7wG)OS`P`ڻ` X`[Gڻ`>  9DS TUT]`> Gt ;r9r DOà`PG` >`ju(`> Gt`:Gs SQ LY[G X` o rKO3%GG`7wG)OSڻ`> ^[G `P`ڻ` BX`DOX`û`> $` ```RQ` YZù (C` t/`:Gu2G;tG;u  )ËGGá`u`⻋`t`GڋOډOU ]``f`  uډ wr0G+Gs/>`t؀>``u;`s``⺠``t>``u` û`>`f `:Gs rtËG t)ڋ+3Wr PGQڋ)Ys ;Gr9X ڕ\UD]`fݹ ``COMSUBOriginBUnitDataCodeCONOUTSYSDATUndDataUndCodeTSTUND DEXLAT0SHL7BX7DECOUTuUNLINKLNKENDLNKBEGDMSDMSBXUPRCASCALCBVLDIRLDDRGETSDS!00`ù Cty$8u ;uCC QYô '    d ĺ )sӄut 0PS3[XËGډGË_OW ډO[  .CtS[ E u4ULNM0 t   U M E u]M LN udWߊE< t[<uS] ، EEU u D? ?E E E]M_SQ Z[t_0 _Et^3  441- G  G ࣌O O HYr*G סHш>N ѰfucQʋG PRHш>N Ѱ5u2Xш>N X@װuG tGSUp װA؊ֺՈ t@t Ju簉0Pp X][Gá u`u$@t t>NG<@t f>FtP>F u ~uq>F duW0R>F պ$ t Ju4$ u Ju>F պ$ t Ju0GQ 4c]"u"uHtSU][㢅Y øÀtttJtNULF1ø\=.tGUSVWQVWϾ\&GF_^\__^[]1ûp 1ûp 1ø6TurboDOS 1.43, Copyright 1986, Software 2000, Inc. $($/$)$ <-- $Invalid command$Command not found$Program load unsuccessful$Non-privileged user$ \>!4LCOLDSTRTAUTWARMSTRTAUT rrvv45 5X5_59e5EE5554''.7Hq0E''EEF(F.."(.( P(W(RA]AhAqABB614b4F45584=>@@@ >>d(k(6=I=74(r(y7  |~.++.+99G;.<<<=4 == =4T. 6DIRDSK4jUUUUUUUU:_:_:_:_:_:_:_:_.000000000000011 1$1*1.1$ DSK4=1$ JsL-PRINT- 00096rrxx|| `C4#7 L/F Technologies, TurboDOS-16 1.43+16d.01 (OLDSPOOL)$ 0cO..Ha_...@3;Zx0N CRTCG-;Zx0Nm      4      6 y B .QLLhMMMMMMMMAMPQO2QPQO,Q"N*N1N8N\NSCC0kNONd PE P% SCC1kNONnd E8 8 PN N D@   P   rt~SK>)rT-T`S+StQ|QQQQACE0QRfQ`  % ACE1QRfQ`   2 2 ACE2QRfQ` 4b_ _ %u u ACE3QRfQ`  % ACE4QRfQ``  % ACE5QRfQh` ( ( %> > ACE6QRfQp` k k % ACE7QRfQx`  ) ;@+&   4 e` c c kU<r r X YYYZZD]][\ \v\^^Xs]}XXM$M$M$P((W@ A$B(CI 2J Hj HK*P &:G: 6 ( 5tfxF80 &F81 &F82 &F83 &F50 aF51 aF52 @aF53 ea  44 t @ u EEEt0\UD]&C$ `4DU tLU `D' sD' tu$Êt0tL'_ ÊEE $`Ct:E tCE &``:E t uK4,E0NETLODOriginBUnitDCodeALOCMBPRCREQSNDREQGETREPPRCREPDMBCOMGETNMB SAVRRN GETCRA GETFXA INCRRN RESRRNNETLODONETRDFNETWRFW u9_SQZ[u/u(WRE@tDj E[_t  _DOtjWߊ DT u9_SQZ[u/u(WRE@tDj E[_t _DODjtj|S"u Wߊ 47AQucMZRJueSQ Z[YuCQRSDj |S"t &&'u &&'u CC& [ZYu DODOY_|S"u DjMSGFMTOriginBUnitnDataCP1FMT<TDXFMT((hhh8(h8((8(( h@ P((hNETMGROriginBUnit#DataVCodeNMBCKTCRPROCSETDDFALLOCCKTASTRCVMSG LNKBEG UNLINK S4VCMGR TSTUND SNDMSGFWDTBLDELAYNMBMBS NMBRPS!MAXMBS"MAXRPSNETNIT DEALMBqRCVREQRRRMSG|RCVREPXCHGSDSNDREPSNDREQALOCMBc g !` tES`N[u`tQ  Y` tQ  YNWXP`Ê/ uGu n `/ ``t`;Gu` :G t Sڻ` 48[S_ [9tGu RS x[Z0 nû ` tA``tW׋E;GuE:G _ti fRSڻ` [ZS PZ` W eE_]``tW׋E;GuE:G _t RSڻ` [Z_ RӋWO_u  Zû Ӏ' ӀӊoGuGR [ruGu J 0ÊGt  Q YGR m[uS``t ;Wu E``t ;W u / [G`GGWW G G G0GG4/ Rw  [Zû`Ct 8tC/`&`C8tCCCuӋWÉ``` u`G`G `G G GGGGGG0Ë]UډU]Ë``t 0û`!t`:s `tE I̻` ``t 0û`"t` :s ` t ̻` û NETTBLOriginBUnitDataCKTDRACKTDRBCKTDRCCKTDRDDEFDIDCKTASTFWD4 <TBLNMBCKT!` ` ` ` DSPCHROriginBUnitVDataICodeXTNTRYDEALOCALLOCLNKENDUNLINKLNKBEG GETSDSTICCNTRDYSPHCTPFCN/CRPROC=GETWSBsSMFCNySNDMSGSIGNALRMFCNRCVMSGWAITLNKPOLISRXITSETDRFDISDSPDSPIFRENADSPDPFCNDELAYRESUMEDLYTIC6GETTOSDSETDDF"a c T 55:;   _XW5<E[[Y+_XWpw (O P_(K(J (jPN Pn(#I (3M P3]>^e ~hM45/M 4MMM =4M M M           $- &/ (1!*3#, %. '0 )2"+          DW1100\\Z  5 s&)`)`_`n`````ddecd)eddd cdBdTAPEFCNS- )G$> F%G=tO>F"0:GG u0>~- 6>F/zS^[>F$>~->F/Y>F2t>FGt @G55HOSBOOTOriginBUnitdCodeCODEDATAINITSELECTXFERREADOSBOOTYOSLDFN```؎м  0 u <r .G $  1    uǸ  1  &u`Y&.*G$t΃ uMu &Ŀ W &G Ĉ& [C0  Ht7CSӠ $* 0QY    %t[ % O  u[ 35n u띋    A)sy    u Ê  OSLOAD CMD )t*02ϡ$+0'>)u=r= r*$00$')GDuFձ u>F չ $@u JuGGÊG$ >F GÊG pF Q  $ t JuY Y>F C⿰[G ÊG$t @>F >Ft6 @t' Ku!`4 `8` HuG `9 $ uGú  $p<0t $@uJuհ؋G O ȜPЈЋG= v- G `@ `@ G`@ `@O O HYr*G  ס`@Hш>N Ѱ`B fuc Q ʋG  P`@RHш>N Ѱ`B 5u2Xш>N X@װ`B  uG t GSU`A؊`Bֺ Ո t@t Ju簉0P` X][Gá`6 u `4`8` u `9 $@t t  6 6vt[t]t_ i <D_D]D[DYDWDUDSDQDO t ËdaDO DetPpD_t]l[|YtWTULS\QDO t^qVrƉ\QLSTUDW|Yl[D]D_DO srKDS u`<2%`t;`sx`ruWuWt]`\G`Z`Z 5tS[t `\WuW9s S `ZG`\ H= uʉW[ ^>`t E`3u`/`*`,`0`2`-`3Dj`*a` t7O-S po>au ؋` Q ` EY[ Ìػ`*.`3 0`3; :`* Gt Q`Z W@u¹ `\S [Y DO= ta>`1rZ`'tS6`'`)`!u? u: `*t.SP WX G[GS_&[`DlDjQrVtjtl PDj llQ XUHP$ X@Q 3 Ƅ @DlY]X DlDjU a*]Y ú` $`*`^`Z9FILCOMOriginBUnitData|CodeXTNTRYSYSDSKDSKASTDEXLATLOGUSRCOMPATRDSFCNSELFCNRCDFCNSDFCNSRUFCN<SSCF6CNHDFSFCNjSDBFCNqRDBFCN~SESFCNSERFCNLOGFCNSCFFCNDSKERRjGETCRASAVRRNRESRRNINCRRN INCRRC1GETFDHGETF5AVGETFXA[GETS1A`GETS2AeGETRCAvGETABSDj ÊDU$DiÊDiDOËDUDjÊDU DOË\Ut`à`DOË\UD]&O&G&&CIQS 9[Yò :`t & ut` t:`t `t : :`t!: `t: `t: `uڀ  u   tQY Dgtȴ` Ê/_tCONTBLOriginBUnit DataCONDRAATNCHRRESCHRABTCHRECOCHR 77>NG<@t f>FtP>F `4 `8 u `4 `8 ~ uq>F `4 `8 duW0 R >F պ  $ t Ju4  $ u Ju>F պ  $ t Ju0GQ "`8uU"`8u`4H`4tSU ][`9Y`4 g=!%9! a!! a<< 377QUEMGROriginBUnitDataxCodeXCNTRYALLOCLDIRLNKBEGDELAYUNLINK DEALOC SYSDSK UPRCASQUEDLYQUEDRVMQFCNOQFCNDQFCNURQFCN4CRQFCNUWQFCNCWQFCNCLSAQPa DS \UD]` tjtlDj`( \lDnPDn`u`t `t `(S C\UD]&WRSӅuC B)s˅tB[&O It r)ӉZ[7GOW~` ! G"u `u` OO ڱDO XDnDlDjDS \UD] +uA tDO Sڃ݋\UD] ZR - ˌ؎ ZR` [tjtl\l 2Ӊ\jR ӀOZu9R G!G"G#!Zu Ӌ Ӊ\UD]&W 0DO 3 DlDjDS  u"R ӀgZuR ZtDO DS tjtl\l u 2Ӊ\j Wt `DO {7 DlDjDS tjtl\l @u 2Ӊ\j t DS DO CDlDjË\UD]&_QRS [ZYu3t/RQڹ 2ˎD] C&CڋFHFtYZuDS tjtl\l u 2Ӊ\j Wt `DO DlDjDS tjtl\l yu 2Ӊ\j t DS DO |DlDjË\UD]&_t-RQڹ 2 ˇڎD] &CڈCڇ^Kۇ^tYZQRS [ZYuuY PQ @ R *Z Ӌ +[X  G!G"G#Ë`7`t  R ZÅt  à` `U쨀t U S 6 `> `[ > `7iU쨀t GU W U@t G Uu6` Un6``n.6` U.n.6`.`.nU  ) rrvv45 5X5_59e5EE5554''.7Hq0E''EEF(F.."(.( P(W(RA]AhAqABB614b4F45584=>@@@ >>d(k(6=I=74(r(y7  |~.++.+99G;.<<<=7  77<`C` Ct` S[ڌ،Z T륀>``t b`R 5[CuC`  ` ` u ``'< u `/< u CCMCD`5t`3 `,`2`& t `F`&; @u ` ` `J   $ ?t *t`J  /t t`Z `o` % rڈCځ`r  sSC`r[K`n`n ػ`J.` \  `&x``5t 7`3 K`` s  `N`&u#`t` u±>`u  0DS \UD]&&_S Z` SDU &< uCڻ`S P[  7rCtu) r8t"<.tE<:tI`  r!t4u ru)< u r tJ ZS` ،[[ \Oð(t`C<0r<:s<,0Ġ`%t`%Q`#rrrrr< s `#Yt$YDPFCN?AMFCN@DMFCNASMFCNBRMFCNCSESFCNDSERFCNESDTFCNFRDTFCNGRDMFCNHROUFCNISCFFCNJLOGFCNKLFFCNLADFFCNMALDFCNNSCLFCNORAVFCNPRDPFCNQSRSFCNRPDAFCNSSBPFCNTRBPFCNULFDFCNVFFBFCNWSRPFCNXEOPFCNYSRDFCNZQPFFCN[FLBFCN\RCFCN]CCSFCN^CCIFCN_CCOFCN`SCB7FCNaRCBFCNbSMCFCNcRMCFCNdEXTFCNeRDDFCNfTOFFCNgTMFFCNhTLRFCNiTFRFCNjSFLFCNkRFLFCN;lCodemDISDSPnSETDR1oCKATTNpENADSPqGETSDSrGETWSBsNETREQtPFNFCNuDT3FCNvMPMFCNwTSTUNDlOCNTRY lOTNTRY#lXCNTRY0lXTNTRYlERRXIT``````` ` ` ` ` ```````````````` ``` `!`"`7 #`$`%`&`!#` '`(`)` *`+`",`-`.`/`0`1`2`3`4`5`6` 7`8` 9`:`;`<`=`>`?`@`A`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[` \`]`^`_```a`b`c`d`e` f`g`h`i`j`k`l    damno u    tOtQtStUtWtY 888RTC186MDataCodeSYSSEGMASTERRTCLNITEVERYSECDLYTICISRXITRTCNIT?;Zx0N#I!VW.`؎>`t 1  ء =  5u â R V 1ػ `_O 2 _^.``I&`K.`&`I```<`%u4>`"u-`# u>`&u>8`!u `" `!P`!`# E`"`%8~ `#`& *<~&`# u>`&u`!u`"`"ȍ`?ע`! á`#-  `" `&  6`!   6`   BBFÈ$ 0P% XË`# &`K% &`M u>`&t@1`"H`'1`!ȣ`  ú u8 s``````u  ĺ ` `&`# au`"8;1 <t< >`!u `!`& G 8RTC1081Data]CodeGETSDSRTCSECDLYTICISRXITRTCNIT R 5 V 1ػ `(O 2 PQRSUVW``<; Search drive for command files = system disk JDATE = 0x3639 ' ; Cold-start date = Jan 01, 1986 ; ;&== ; PATCHES ;&== ; ; Patch 81.43-01 ; ; The following patch is applicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fcn 15 opening the ; files $.DIR or $.DSK when FCB byte 32 is FF. The ; 'PATCH' module must be included during system generation. ; OPNFIL + 0x4A = [PATCH] PATCH = 0xE8, [CKSPFN], 0xB0, 0x00, 0x74, 0x03, 0xE9, [OCECOM],  ,0x83, 0xC4, 0x02, 0xE9, [OPNFIL + 0x59] ; !8RLCLUSROriginBUnitDataCodeCRPROCCLBNITSYSDATDBCFCNOTNTRYOCNTRY SETDR2 DSPIFR TSTUND USRSOM SYSDSKSPLDRVPRTMODQUEPTRCOLDLDSUBMITWARMLDCMDINTBASPAGCLSAQPAUTLOGWSRESCONSTATNCHRXFRCDCOLCNTLOGUSRCKDOSTCKBMST CIRES!LCLDES"GETSDS#GETWSBDSKSAVUSRSAVGSX86COLDSTLCLNITFCINTRY8i*WARMSTCLRCDCcTurboDOS 1.43, Copyright 1986, Software 2000, Inc. $($/$)$( `0.`.&`.`.&` .`.&` τt2ut6u .` t.`uV C.` ^1.`u.&`.`.&` Dg 0 `` $n`c G  tRS` 5[ ` +[ ` ! ` t8- . ```u.` `` u؎ڱ3 .` U.` .` 0 \,`` :@u tVtXtNtP<t,tBt`t 1  ء =  5u â R V 1ػ `_O 2 _^.``I&`K.`&`I```< `U쨀t U S 6 `> `[ > `9999 ^SCD186SData5CodeNMBCKTCKTASTWAITSIGNALGETSDSISRXITCKTIN_7CKTDR_ a a a?1ػ 8`O R <Z`` :7tÈW7Ȅtt=ÃR` Z؎W It _&``@t &`` 0ÃR``t`@` Z`  o%V֊ V^&`߻`0 99External Buffer Area with 256k RAM disk ;RDBAS = (0x4000) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ; SET THREE - for 1024K bytes (one megabyte) ; ;RAMBUL = (0xEFC0) ; Top of TPA with no RAM disk ;TRKBUF = (0xF800) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0xF000) ; Start of External Buffer Area with no RAM disk ; ;RAMBUL = (0xCFC0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0xD800) ; Floppy9} Track Buffer with 128k RAM disk ;BUFBAS = (0xD000) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0xDC00) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0xAFC0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0xB800) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0xB000) ; Start of External Buffer Area with 256k RAM disk ;RDBAS = (0xBC00) ; Base of RAM disk with 256k RAM disk ;RDL9EN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ;RAMBUL = (0x8FC0) ; Top of TPA with 384k RAM disk ;TRKBUF = (0x9800) ; Floppy Track Buffer with 384k RAM disk ;BUFBAS = (0x9000) ; Start of External Buffer Area with 384k RAM disk ;RDBAS = (0x9C00) ; Base of RAM disk with 384k RAM disk ;RDLEN = (0x6000) ; Size of RAM disk with 384k RAM disk ; ;RAMBUL = (0x6FC0) ; Top of TPA with 512k RAM disk ;TRKBUF = (0x7800) ; Floppy Track Buffer with 512k R9BAM disk ;BUFBAS = (0x7000) ; Start of External Buffer Area with 512k RAM disk ;RDBAS = (0x7C00) ; Base of RAM disk with 512k RAM disk ;RDLEN = (0x8000) ; Size of RAM disk with 512k RAM disk ; ; ; ROM starts at 0xFC000, which is tqhe effective end of memory ; ; IF YOU PLAN TO USE TURBOGEN, DO NOT CHANGE OSMLEN & OSMTOP ; OSMLEN = (0x1000) E; Reserved memory for buffers and working storage OSMTOP = (0x0000) ; Absolute top paragraph ; ;===9q=== ; DISKS ;&== ; ; If you change BUFSIZ & NMBUFS, change RAMBUL, TRKBUF, BUFBAS, and BUFLEN ; to reflect the new buffer requirements ; BUFSIZ = 6 * ; Disk buffer size = 8K bytes NMBUFS = 4 ? ; # disk buffers allocated at cold-start (4) BUFLEN = (0x800) 0 ; Number of paragraphs in BUFBAS ; SRT431 = 3  ; 6 msec step rate for9 Shugart 5" drives SRT401 = 8 ~ ; 8 msec step rate for Shugart 8" drives ; ; Disk Assignment Table ; DSKAST = 0x00,(DSKDRA) ; Drive A = floppies  0x01,(DSKDRA) ; B  0x02,(DSKDRA) ; C  0x03,(DSKDRA) ; D  0x04,(DSKDRA) ; E  0x05,(DSKDRA) ; F  0x06,(DSKDRA) ; G  V0x07,(DSKDRA) ; H ; ; Choose one of the next two Sets depending upon whe9mther you have a ; Winchester controller. ; ; SET ONE: choose this set if you do not have a winchester. ; 6 0xFF,(0x0000) ; Drive I is not in the system ; 6 0xFF,(0x0000) ; Drive J is not in the system ; 6 0xFF,(0x0000) ; Drive K is not in the system ; 6 0xFF,(0x0000) ; Drive L is not in the system ; 6 0xFF,(0x0000) ; Drive M is not in the system ; 6 0xFF,(0x0000) ; Drive N is not in the system ;  0xFF,(0x0000) ; 96Drive O is not in the system ; 0xFF,(0x0000) ; Drive P is not in the system ; ; SET TWO: choose this set if you have a 1100 DMA winchester controller. ;  00x00,(DSKDRB) ; Drive I = DMA winchester  0x01,(DSKDRB) ; J  0x02,(DSKDRB) ; K  0x03,(DSKDRB) ; L  0x04,(DSKDRB) ; M  0x05,(DSKDRB) ; N  0x06,(DSKDRB) ; O  0x07,(DSKDRB) ; 9 f P ; ; If using a TurboDOS RAM Disk, the RAM Disk must be mapped into the Disk ; Assignment Table. ; ; 0x00,(DSKDRC) ; Substitute this value into the drive position ; ; you wish the RAM Disk to reside. ; ; NOTE: When using th5e TurboDOS RAM disk, DO NOT use Turbogen to modify ; -the memory, buffer, or disk parameters. ; ;&== ; MISCELLANEOUS ;== ::+`&`&`S`` u 5 A<u `` " a`&`  RP . $tXZR .$ tZ-ú u .  ú u &   [`````` Í6`  1 R  1ZuBBF 1 `# 1`% 1`&À>`%u4>`"u-`# u>`&u>:::;&== ; ; SLV1081.GEN  TurboDOS v1.43+ [ 07 May 1986 ; ; These are the modules used for the model 1081 16-bit slave ; CNFTBL f ; Configuration Table for Tgen STDSLV86 ; Modules for an unbanked network slave system CPMSUP ! ; CP/M Function Support ;MPMSUP ; MP/M Function Support ;QUEMGR '; MP/M queuing function support USRSOM - ; User Sign-on Message Area, filled by SLV10:881.PAR NIT186 @ ; Cold-start initialization, particularly hardware init SPD186 6 ; Serial & Parallel Drivers for 16-bit slaves SLVRES $ ; Keyboard Reset subroutine SCD186 2 ; Slave Circuit Driver for 16-bit slaves RTC1081 #; Periodic Interrupt source MST256  ; Memory Tables (256K) CONSOL  ; Terminal Handler ;SUBMIT '; CP/M "SUBMIT" function support PATCH ; Software 2000 Patch Area ; ;===:$O === ; PRINTER SELECTION ; Choose one or none. ;&== ;LST300 2; No-handshake Serial Printer at 300 baud ;LSTCTS '; Clear-to-Send Serial Printer ;LSTXON "; XON/XOFF Serial Printer ;LSTETX ; ETX-ACK Serial Printer ;&--K ; If you want to spool to your local printer, enable DSPOOL. ; ;DSPOOL:o< ; De-spooler: sends chars from spool file to printer ; ;&==@ ; USER-WRITTEN DRIVERS ; If you have any, add them here. ;&== 5@:);&== ; ; SLV1081.PAR TurboDOS v1.43+ 11 May 1987 ; ; This file contains patchable parameters for the file SLV1081.GEN ; ;&== ; USER INTERFACE ;&==s ; ABTCHR = 0x03 ; The sequence ATNCHR-ABTCHR will abort current process ATNBEL = 0x07 ; ATNBEL will be echoed:  when ATNCHR is detected ATNCHR = 0x00 ; Halt process ECOCHR = 0x10 ; The sequence ATNCHR-ECOCHR will echo screen output to  ; to the current list device until ATNCHR-ECOCHR is retyped PRTCHR = 0x0C ; The sequence ATNCHR-PRTCHR will enqueue the print job RESCHR = 0x1E ; RESCHR, after ATNCHR, will resume process SLRCHR = 0x1F ; Typing this character consecutively will resqet the slave CLBLEN = 0x9D ; Longest legal command line = 157 bytes CLPCHR = ">" ; Prompt character, display :g:{e serviced ; ; Set NMBSER equal to the number of channels indicated by the configuration ; you chose above. ; NMBSER = 2 ; Configuration A ; ; ;* Printer Assignment Table: per order in STDSINGL.GEN ; ; This table assigns a driver to each Channel in your configuration. Which ; driver is "LSTDRA" depends upon which one is listed first in STDSINGL.GEN. ; ; The assingnments for Channels 2 and 3 are commented out and are meant to ; serve as an example in case you need to ad:d more drivers. ; To use two parallel printers, use the second set of instructions. ; PTRAST = 0x01,(SERIAL) ; Printer A = Channel 1, CTS printer  B0xFF,(0000) ;Terminate the table with an "undefined" printer ; 4 0x02,(SERIAL) ; Printer B = Channel 2, XON/XOFF ; 3 0x03,(LSTDRA) ; Printer C = Channel 3, ETX/ACK ; 0x11,(LSTDRB) ; Printer D = centronics parallel printer (LSTCNT) ; ; To use two parallel printers, enable the following two patches. ; When using thi: 2s patch, however, TurboGEN must NOT be used. ; ; E 0x00,(LSTDRB) ; Printer D = centronics parallel printer (LSTCNT) ; o 0x01,(LSTDRB) ; Printer E = centronics parallel printer (LSTCNT) ; ;* Driver Patch Points ; ETXBR = 0x0E B; ETX/ACK driver: Protocol = none, Baud rate = 9600 ETXLEN = 0x8C -; # fill characters for ETX (140) ETXSEQ = 3 / ; Length of ETX escape sequence ETXFF = 0x0C :; ^L Formfeed for ETX/ACK printer ; CNTFF = 0x0C :j ; ^L Formfeed for centronics parallel printer ; ;* Channel Patch Points ; ; The patch points for Channels 2 and 3 are commented out and are meant to ; serve as an example in case you need to add more drivers. ; ; Channel 1, in the default c4onfiguration, is a CTS printer ; SDCB1+0x0F = 0x6E 3; CTS, Input Disabled, 9600 baud SDCB1+0x10 = 0x64 @; DTR high, 8 bits-per-char, protocol enabled SDCB1+0x16 = 0x0C B; ^L End-of-print character = Formfeed SDCB1+0x19 = (0x0005) ;: Input buffer size 5 characters SDCB1+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 2, in the example, is an XON printer ; ;SDCB2+0x0F = 0x1E ; XON, Input Enabled, 9600 baud ;SDCB2+0x10 = 0x64 ; DTR high, 8 bits-per-char, protocol enabled ;SDCB2+0x16 = 0x0C ; ^L End-of-print character = Formfeed ;SDCB2+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB2+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 3, in the example, is an ETX/ACK print:qer ; ;SDCB3+0x0F = 0x0E ; No protocol, Input Enabled, 9600 baud ;SDCB3+0x10 = 0x60 ; DTR high, 8 bits-per-char, protocol disabled ;SDCB3+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB3+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ;&== ; SPOOLING ;&==? ; ; Spooling is not supported in STDSINGL.SYS ; PRTMOD :i= 0 ) ; Default printmode = print direct ; ;&== ; PHYSICAL CONFIGURATION ;&== ; ;* Memory - choose the values of RAMBUL and TRKBUF according to the amount ; of memory in your system. All values are paragraph (segment) values. ; ; If you wish to have a RAM disk, choose the sub-set for your ; memory size and RAM disk size. : Note that RAM disk is not supported ; on masters with less than 512k bytes of memory ; ; SET ONE - for 256K bytes ; RAMBUL = (0x33C0) :; Top of TPA (No RAM disk recommended) TRKBUF = (0x3C00) (; Floppy Track Buffer BUFBAS = (0x3400) ; Start of External Buffer Area ; ; SET TWO - for 512K bytes ; ;RAMBUL = (0x73C0) ; Top of TPA with no RAM disk ;TRKBUF = (0x7C00) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0x7400) ; Start of External Buffer Area wit: h no RAM disk ; ;RAMBUL = (0x53C0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0x5C00) ; Floppy Track Buffer with 128k RAM disk ;BUFBAS = (0x5400) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0x6000) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0x33C0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0x3C00) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0x3400) ; Start of ;y;eied when OS ready for command CLSCHR = "\\" ; Command separator, for multiple commands on one line ; ;&== ; LOGON ;&== ; AUTUSR = 0xFF ; Force user to logon COLDFN = 0,"COLDSTRT","AUT" ; Drive # & file name for cold-start autoload WARMFN = 0,"WARMSTRT","AUT" ; Drive # & file name for warm-start autoload LDCOLD = 0xFF ;M +; Enable cold-start autoload LDWARM = 0xFF , ; Enable warm-start autoload LOGUSR = 0x1E k ; User logoff number = 30 USRSOM = 0x0D,0x0A,"L/F Technologies, TurboDOS-16 1.43+16d.01 (SLV1081)$" ; ;&== ; NETWORK ;&== ; DEFDID = (0x0000) = ; Default Network Destination ID CKTAST = (0x0000),(CKTDRA);`c2 ; Circuit number and driver entry point ; ;&== ; SPOOLING and PRINT CONTROL ;&== ; PRTMOD = 1 '; Default printmode = spool QUEPTR = 1 *; Default Printer is Printer A EOPCHR = 0 ; A "null" in the print stream will terminate printing. ; ; Queue Assignment Table ; QUEAST = 0x80,(0000) ; Queue A is remote, on;) Circuit 0 Node 0  A0xFF,(0000) ; Terminate the table with an "undefined" queue ; < 0x81,(0000) ; Queue B is remote, on Circuit 0 Node 0 ; ; 0x82,(0000) ; Queue C is remote, on Circuit 0 Node 0 ; < 0x83,(0000) ; Queue D is remote, on Circuit 0 Node 0 ; 0x00,(0000) ; Queue E is local. ; ; Printer Assignment Table: per order in STDMASTR.GEN ; PTRAST = 0x80,(0000) ; Printer A = remote CTS printer  '0xFF,(0000) ; Terminate the table wi;th an "undefined" queue ; B 0x81,(0000) ; Printer B = remote XON printer (if it exists) ; B 0x82,(0000) ; Printer C = remote ETX printer (if it exists) ; E 0x83,(0000) ; Printer D = remote parallel printer (if present) ; e 0x01,(LSTDRA) ; Enable this line if you have a local printer ; ; Dispatch Table ; DSPPAT = 01 ) ; Printer A will be fed from Queue A, ;  02 , ; Printer B from Queue B, (if it exists) ;  03 ; Printe;J#r C from Queue C, (if it exists) ;  04 , ; Printer D from Queue D, (if it exists) ;  05 ; (local) Printer E from (local) Queue E ; ;* PRINTER-ON-SLAVE ; ; SET ONE: Correct and enable this set if the printer on Channel 1 is CTS ; ;CTSBR = 0x6E B ; CTS printer: Protocol = CTS, Baud rate = 9600, ;CTSFF = 0x0C ; ^L Formfeed character for local CTS printer ; ; SET TWO: Correct and enable this set if the printer on Channel 1 is XON ; ;XONBR;c = 0x1E 0 ; XON printer: Baud rate = 9600 ;XONFF = 0x0C ; ^L Formfeed character for local XON/XOFF printer ; ; SET THREE: Correct and enable this set if the printer on Channel 1 is ETX ; ;ETXBR = 0x0E 4 ; ETX/ACK printer: Baud rate = 9600 ;ETXLEN = 0x8C 5 ; # fill characters for local ETX (140) ;ETXSEQ = 3 5; Length of local ETX escape sequence ;ETXFF = 0x0C 8 ; ^L Formfeed character for local ETX/ACK printer ; ; ==;s== ; CONSOLE ;&== ; ; The patch points below are set for a console on Channel 0. If your ; console is on Channel 1, you must change the CONAST channel assignment. ; The baud rate is set to 9600. To change the baud rate, adjust the ; least significant ]digit of CONBR according to the tables in Turbogen. ; Some commonly used rates are: ; ;  x7; s = 1200 baud xE = 9600 baud xF = 19200 baud ; CONAST = 0,(CONDRA) ; Console Channel # & driver entry point ; CONBR = 0x8E . ; Console = 9600 baud, attention detect ; ;&== ; PHYSICAL CONFIGURATION ;&== ; ;&== ; Disks ;=== ;;;M/;&==' ; ; STDSINGL.PAR TurboDOS v1.43+ \11 May 1987 ; ; This file contains patchable parameters for the file STDSINGL.GEN ; ;&== ; USER INTERFACE ;&=={ ; ABTCHR = 0x03 ; The sequence ATNCHR-ABTCHR will abort current process ATNBEL = 0x07 ; ATNBEL will be echoed when AT;zNCHR is detected ATNCHR = 0x00 ; Halt process ECOCHR = 0x10 ; The sequence ATNCHR-ECOCHR will echo screen output to  ; to the current list device until ATNCHR-ECOCHR is retyped PRTCHR = 0x0C ; The sequence ATNCHR-PRTCHR will enqueue the print job RESCHR = 0x1E ; RESCHR, after ATNCHR, will resume process CLBLEN = 0x9D ; Longest legal command line = 157 bytes CLPCyHR = ">" ; Prompt character, displayed when OS ready for command CLSCHR = "\\" ; Command separator, for multiple comm;Qands on one line ; ;&== ; LOGON ;&== ; AUTUSR = 0x80 ; Priviledged user 0 logon COLDFN = 0,"COLDSTRT","AUT" ; Drive # & file name for cold-start autoload WARMFN = 0,"WARMSTRT","AUT" ; Drive # & file name for warm-start autoload LDCOLD = 0xFF , ; Enable cold-start autoload LDWARM = 0xFF  ; Enab;8e%le warm-start autoload LOGUSR = 0x1E l ; User logoff number = 30 USRSOM = 0x0D,0x0A,"L/F Technologies, TurboDOS-16 1.43+16d.01 (STDSINGL)$" ; ;&== ; CONSOLE ;&== ; ; The patch points below are set for a console on Channel 0. If your ; console is on Channel 1, you must change "SDCB0" to "SDCB1" as well ; as the CONAS;T channel assignment. Each option listed here sets the ; baud rate to 9600. To change the baud rate, adjust the 2nd digit of ; CONBR according to the tables in Turbogen. ; Some commonly used rates are: ; ; x7 = 1200 baud xE = 9600 baud xF = 19200 baud ; CONAST = 0,(CONDRA) ; Console Channel # & driver entry point ; ; Choose the next two parameters if you have a "no protocol" terminal. ; CONBR = 0x8E 2 ; Console = 9600 baud, no protocol SDCB0+0x10 = ;0x64 ; DTR high, bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have a CTS terminal. ; ;CONBR = 0xCE ; Console = 9600 baud, CTS ;SDCB0+0x10 = 0x64 ; DTR high, bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have an XON/XOFF terminal. ; ;CONBR = 0x9E ; Console = 9600 baud, XON/XOFF ;SDCB0+0x10 = 0x60 ; DTR high, bits-per-char = 8, protocol enabled ; ;* Buffer Parameters ; SDCB0+0x19 = (0x0050;o) ; Input buffer size = 80. bytes SDCB0+0x2F = (0x0050) ; Output buffer size = 80. bytes SDCB0+0x1D = (0x0005) ; "Start Receive" threshold: send XON or raise CTS SDCB0+0x1F = (0x0045) ; "Stop Receive" threshold: send XOFF or drop CTS ; ;&== ; PRINTERS ;&==N ; ; LFT supports 3 configurations of serial devices. Each of ; these co; enfigurations starts with the two serial ports on the Model 1230 ; board (Channels 0 and 1). Usually, Channel 0 is the terminal. The other ; configurations depend upon your mixture of Serial Boards. ; ; If you have: % Set NMBSER to: ; ; A. 1230 only:  2 serial devices: 2 ; B. 1230 + 1250:  8 serial devices: 28 ; C. 1230 + 1250 + 1250: 14 serial devices: ) 14 ; ;* Number of Serial Channels to b <<^o=== ; ;* Remote Disks are all on the master, via Circuit 1 ; DSKAST = 0x80,(0x0000),0x81,(0x0000),0x82,(0x0000),0x83,(0x0000)  90x84,(0x0000),0x85,(0x0000),0x86,(0x0000),0x87,(0x0000)  90x88,(0x0000),0x89,(0x0000),0x8A,(0x0000),0x8B,(0x0000)  =0x8C,(0x0000),0x8D,(0x0000),0x8E,(0x0000),0x8F,(0x0000) ; ;&== ; MISCELLANEOUS ;======<#== ; COMPAT = 0xB0 ; File Access: Permissive, global-write, mixed mode CPMVER = 0x31 ; CP/M BDOS version returned by C-fnc 12 SRHDRV = 0xFF ; Search drive for command files = system disk ; ;&== ; PATCHES ;&== <<<<b;&== ; ; SLV1240.GEN  TurboDOS v1.43+ Z23 Dec 1986 ; ; These are the modules used for the S100+ bus 16-bit slaves ; CNFTBL R ; Configuration table STDSLV86 ; Modules for a 16-bit slave system CPMSUP ! ; CP/M Function Support ;MPMSUP ; MP/M Function Support ;QUEMGR '; MP/M queuing function support USRSOM @ ; User Sign-On Message area, filled by SLV1240.PAR NIT186 <B ; Cold-start initialization, particularly hardware init XTISR #; Interrupt Initialization MEMTBL * ; TurboDOS memory fragment tables RTC186 , ; Periodic interrupt source handler XS3040  ; Serial I/O driver CONSOL  ; Terminal handler MCD ; Master Circuit Driver CKTDCB ) ; Circuit Device Control Blocks ;SUBMIT 4; To emulate CP/M processing of $$$.SUB files PATCH ; Software 2000 Patch Area ; ;===<dS=== ; PRINTER SELECTION ; The serial driver can handle CTS, XON, or no protocol. If you wish to use ; ETX/ACK enable this handler. ;&== ;LSTETX ; ETX-ACK Serial Printer ; ; If you want to spool to your local printer, enable DSPOOL. ; ;DSPOOL ; De-spooler: sends chars from spool file to printer ; ;&== ; < e RAM DISK ; ; If you wish to have a RAM disk on your slave, enable the SLVMDSK module ; ; NOTE: When using the TurboDOS RAM disk, DO NOT use Turbogen to modify ; 4the memory, buffer, or disk parameters. ; ;SLVMDSK %; Support for TurboDOS RAM disk ; ;&==@ ; USER-WRITTEN DRIVERS ; If you have any, add them here. ;&==   <Q< COMMGROriginBUnitRCodeCOMDRVCCSFCN CCIFCNCCOFCN SCBFCN(RCBFCN4SMCFCN<RMCFCN EDO 9DO - % DO   DOÊLUlVRTCMGROriginBUnitData_CodeTICCNTJDATESECSMINSHOURSSDTFCNRDTFCN,RTCSEC DQ`<DU`DT`á`DQ`DU`DT`DSû`<` t`DSPSGLOriginBUnitDataCodeLNKBEGALLOCTICCNTLNKPOLDPFCN DELAYWAIT(DLYTICESIGNALJCRPROCoRESUME{ISRXIT|DISDSPGETTOSGETWSB"a"`\Uu l``y ] x0``uË`K`tû`0É` SZӉ` S<` YCË&` 6`&` SQR``t7W[ZY[á` á`MEMMGROriginBUnitkDataCodeEndDataMod8080EndCodeMEMTBLUNLINKLNKBEG LDIROSMLENOSMTOPMEMNIT`AMFCNmALLOCDMFCNDEALOCrRRMFCN}RAMFCNARMFCNAAMFCN2FMSFCNFAMFCNINCMOBDECMOB!a%T```u ` :``>`t 9`<Es` r)+` `uH` û`)G`\U \QDOÉ` )s` ` ` ``tW` @@)t/r9`r``ڋ`t`= r GË` BB$0Ë` ` BB)Ӱr;`r ` CCW0Ë\U`W``t5` 9tG;` tWRZ`WR ZW뺋````tHH;` tG` 0ý "uVý  uaý 3tBý  *tODS <  tt`)G`j ڰDODS tDOËG+GG)GAOڋ+G7wG)OS`P`ڻ` X`[Gڻ`>  9DS TUT]`> Gt ;r9r DOà`PG` >`ju(`> Gt`:Gs SQ LY[G X` o rKOGG`7wG)OSڻ`> ^[G `P`ڻ` BX`DOX`û`> $` ```RQ` YZù (C` < t/`:Gu2G;tG;u  )ËGGá`u`⻋`t`GڋOډOU ]``f`  uډ wr0G+Gs/>`t؀>``u;`s``⺠``t>``u` û`>`f `:Gs rtËG t)ڋ+r PGQڋ)Ys ;Gr9X ڕ\UD]`fݹ ``COMSUBOriginBUnitDataCodeCONOUTSYSDATUndDa<taUndCodeTSTUND DEXLAT0SHL7BX7DECOUTuUNLINKLNKENDLNKBEGDMSDMSBXUPRCASCALCBVLDIRLDDRGETSDS!00`ù Cty$8u ;uCC QYô '    d ĺ )sӄut 0PS[XËGډGË_OW ډO[  .CtS[`t;`sx`ruWuWt]`\G`Z`Z 5tS[t `\WuW9s S `ZG`\ H= uʉW[ ^>`t E`3u`/`*`,`0`2`-`3Dj`*a` t7O-S po>au ؋` Q ` EY[ Ìػ`*.`3 0`3; :`* Gt Q`Z =4W@u¹ `\S [Y DO= ta>`1rZ`'tS`'`)`!u? u: `*t.SP WX G[GS_&[`DlDjQrVtjtl PDj llQ XUHP$ X@Q 3 Ƅ @DlY]X DlDjU a*]Y ú` $`*`^`Z9NONFILOriginBUnitDataCodeCOMPATCLSAFPFREDRVCKTASTXTNT=RYUnit Origin USRFCNCPMVERROSFCN RVNFCNDT1FCN`DT2FCNgDT3FCNSRCFCNCLOFCNROUFCNEXTFCN1 ` `DU`DO\_Ë\UD]&R&G &G [ * P$X$t DO &Gñ  * ؋\UD]& &G &G, s ËDU= t`á`DOÀ DS0 t DTDU`DQ ` Ë\QLjTUDl TULS\QDOCONMGR=iOriginBUnitDataCodeINPLNATNCHRCKDOSTDOCONIATNBELRESCHR ABTCHR PRTCHR ECOCHR EOPFCN ERRXITLSTOUTCONASTTSTUNDCOLCNTCIFCNCONIN#ECHO COFCNaCONOUTXRCIFCN_RCOFCNeDCFCNCONSTPBFCNCIBFCNCSFCNSRTFCNPBCFCNwXFRCDCONINICKATTNmCONOIqCONSOuCONSI$ < s< t < t< t<uP XDOÊDU< s(< t < u$=``$*`Q Y`  DOÊLU DUttt t ot mDOË\UD]&C:`t S [Ë\UD] > DOË\Ut`à`DOË\UD]&O&G&&CIQS 9[Yò :`t & ut` t:`t `t : :`t!: `t: `t: `uڀ  u   tQY Dgtȴ` Ê/_tCONTBLOriginBU=nit DataCONDRAATNCHRRESCHRABTCHRECOCHRPRTCHRCONASTATNBEL `DOMGROriginBUnit DataCodeXCNTRYSETCBFUNLINKSAVCLBLDIRCLRCLB LNKBEG ALLOC DEALOCDOCONIADFFCN~CKDOSTa!`uFCtjtl\j\lTn R`DnƄ `ZTn DlDj`tG*Ê< t<u t `` `=  ËDUu Dn`u``t `` Y YuC` ) Ju4` ڌ݋\UD] `G G G$Sڱ[O$t DOÃ`  # ft `S 1[   `t  `t: 5 $tSDnP`DnڱXDn[Ë`Ë``)` ` INPLNOriginBUnitCodeECHODMSCONINCONOUTIN=xPLN &/C&SC0P <t<< s<t4< t5<t<<t8XP8s&CXP< s@Q^ VY N X[&  uZXtP K&< s  XPRSQR  ZY[SQY[SQY[LSTMGROriginBUnitGCodeEOPCHRSPLOUTCONOISPLEOPCALCBVDSPINPTSTUND PTRASTPBLFCNLSTOUT&SRPFCNEOPFCNLOFCNXFRLD\UD]&O&G&IQ&CS [YË\UDT tLQS [Yt <sDh>"r C is on master (if it exists) ; A 0x83,(0x0100) ; Remote Printer C is on master (if it exists) ; - 0x01,(SERIAL) ; local XON or CTS printer ; k 0x01,(LSTDRA) ; local ETX printer ; ;* Driver Patch Points - enable these if you choose ETX protocol ; for your local printer ; ;ETXBR = 0x0E ; ETX/ACK driver: Protocol = none, Baud rate = 9600 ;ETXLEN = 0x8C ; # fill characters for ETX (140) ;ETXSEQ = 3 ' ; Length of ETX escape sequence ;ETXF>F = 0x0C ; ^L Formfeed for ETX/ACK printer ; ;* Channel Patch Points - enable the one appropriate to your protocol if ; you have a local printer. ; ; CTS ; ;SDCB1+0x0F = 0x6E ; CTS, Input Disabled, 9600 baud ;SDCB1+0x10 = 0x64 ; DTR high, 8 bits-per-char, protocol enabled ;SDCB1+0x16 = 0x0C ; ^L End-of-print character = Formfeed ;SDCB1+0x19 = (0x0i005) ; Input buffer size = 5 bytes ;SDCB1+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; XO>$N ; ;SDCB1+0x0F = 0x1E ; XON, Input Enabled, 9600 baud ;SDCB1+0x10 = 0x64 ; DTR high, 8 bits-per-char, protocol enabled ;SDCB1+0x16 = 0x0C ; ^L End-of-print character = Formfeed ;SDCB1+0x19 = (0x0005) ; Input buffer size = 5 bytes ;SDCB1+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; ETX ; ;SDCB1+0x0F = 0x0E ; No protocol, Input Enabled, 9600 baud ;SDCB1+0x10 = 0x60 ; DTR high, 8 bits-per-char, protocol disabled ;SDCB1+0x19 = (0x0005) ; Input buffer si>gMze = 5 bytes ;SDCB1+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ;&== ; COMMUNICATIONS CHANNEL ;&==O ; ; If you are using communications software, the following patches ; =may be helpful. The baud rate and protocol may have to be ; Qadjusted for your particular hardware and/or software. ; ;SDCB1 + 0x0F = 0x0E >g ; No protocol, Input enabled, 9600 baud ;SDCB1 + 0x10 = 0x60 ; DTR high, 8 bits-per-char, protcol disabled ;SDCB1 + 0x19 = (0x0100) ; Input buffer size = 256 bytes ;SDCB1 + 0x2F = (0x0100) ; Output buffer size = 256 bytes ; ;&== ; SPOOLING ;&== ; PRTMOD = 1 '; Default printmode = spool QUEPTR = 1 ; Default Printer is >Printer A EOPCHR = 0 ; A "null" in the print stream will terminate printing. SPLDRV = 0xFF ; Default Spool Drive is system disk ; ; Queue Assignment Table ; QUEAST = 0x80,(0x0100) ; Queue A is remote  A0xFF,(0x0000) ; Terminate the table with an "undefined" queue ; C 0x81,(0x0100) ; Queue B is remote (if it exists on the master) ; C 0x82,(0x0100) ; Queue C is remote (if it exists on the master) ; 6 0x83,(0x0100) ; Queue D is remote (if it exists on t> he master) ; g 0x00,(0x0000) ; Queue E is local if you have a local printer ; ; Dispatch Table ; DSPPAT = 0x01 ) ; Printer A will be fed from Queue A, ;  0x02 , ; Printer B from Queue B, (if it exists) ;  0x03 , ; Printer C from Queue C, (if it exists) ;  0x04 , ; Printer D from Queue D, (if it exists) ;  0x05 / ; Printer E (local) from Queue E (local) ; ;!==>== ; PHYSICAL CONFIGURATION ;&== ; ;* Memory - choose the values of RAMBUL according to the amount ; of memory in your slave. ; If you wish to have a RAM disk, choose the sub-set for your ; memory size and RAM disk size. Note that RAM disk is not supported ; on slaves withV less than 512k bytes of memory. ; ; SET ONE - for 256K bytes ; RAMBUL = (0x3FB0) #; Top of TPA (No RAM disk recommend> ed) ; ; SET TWO - for 512K bytes ; ;RAMBUL = (0x7FB0) ; Top of TPA with no RAM disk ; ;RAMBUL = (0x5BB0) ; Top of TPA with 128k RAM disk ;BUFBAS = (0x5C00) ; Buffer base with 128k RAM disk ;RDBAS = (0x6000) ; Start segment of 128k RAM disk ;RDLEN = (0x2000) ; length in paragraphs of 128k RAM disk ; ;RAMBUL = (0x3BB0) ; Top of TPA with 256k RAM disk ;BUFBAS = (0x3C00) ; Buffer base with 256k RAM disk ;RDBAS = (0x4000) ; Start segment of 256k RAM disk >C>BUnitData|CodeXTNTRYSYSDSKDSKASTDEXLATLOGUSRCOMPATRDSFCNSELFCNRCDFCNSDFCNSRUFCN<SSCFCNHDFSFCNjSDBFCNqRDBFCN~SESFCNSERFCNLOGFCNSCFFCNDSKERRjGETCRASAVRRNRESRRNINCRRN INCRRC1GETFDHGETF5AVGETFXA[GETS1A`GETS2AeGETRCAvGETABSDj ÊDU$DiÊDiDOËDUDjÊDU$0u\jDl&&gËDUDlËDjDODlD_ËDUDcËDUDe @u@DU GETXDR DSTPTDLSTBLCLROTEERRXITDSKERRLNKBEGWAITSIGNALBUFBASBUFLENBUFSIZNMBUFSBMINITBUFMGRBUFMGNLSBPFCNfRBPFCNqFFBFCNCKBMST!c  `;tG tS_[ߠ`t 0````QRS  ZYubG G G G G_G &`İ>`t)r(WSZڄuWO QR [ZYY>h`(u`x 5`D&u !``ՊD( ȈD0D( D( tuv u  D0u/D/@u)\(S` 0)Ӊ\(r {[\(t {y5``9t T1 A 2L` \1 U y\1W` 9Ӊu t w  -@t  t kt  ! l mtD t \1G_t0D&t\+D-T+l-D&tڕ D&t @KD0:rD( D0D(   CD(CD)CD*C`D/tD0C' :>^DU$` DV<s` `&`DQÊDU tÊDU lV t  Ӊ`` t S [u ` 9trӉ\1t:Ouŀu  uP xG u @t2Q %t uY   @ Y@tQ gY u t w\1 ttAŀt<t$`<`u/Q `ˋtSQ Y[Du `Y` ` 9t Ӏ'߉tuË`Q Yŀt Q Y0û` ` 09tS [t\1Ãd' D'>V D':uFC0^d'uD0:r u D/tD À'  tJD$`:Ds u tu % _ VCDF^\1GD"GD 0 / \1 `\1`   uú    \1ÊD' ` ` 9DSKMGROriginBUnit2Data?CodeDSKASTLDIRSHL7BXDSKERRERRXITTSTUNDDSTPTDSKNITBPDAFCN>SELDRVDSKMGRGETXDR `1 QS`ˉ``` ڊ:uBCB['KYyB\U D] t6T DD DOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r u u ;ËL$IDxAL\$\TDdx\ǀuڹ A)syIAx )sڋ\ˋL D"D L \TڋLˇڋ \)s,Sˉ\ Q ZuH\ LډӉ\ 7 \C뻊D\T0)s؎ otD>/  ttDx\ÊD$¶` Ӌu%S *uD t ?`r $($ 3,6;AEI! $ DSK0?sW`ñ # Kú `*J`,ño!"Q c±0 xڻ 0`* ts`,s`O`Q`.R !ZYu  Bñ3 ` ñPGMLODOriginBUnit_DataCodeLDIRINCMOBXCNTRYDECMOBCPMVER*BASPAGPLFCN"DS D]\Uݺ` !tjDj`tl\l ?]? ;RDLEN = (0x4000) ; Length in paragraphs of 256k RAM disk ; ; SET THREE - for 1024K bytes (one megabyte) ; ;RAMBUL = (0xFDB0) ; Top of TPA with no RAM disk ; ;RAMBUL = (0xD9B0) ; Top of TPA with 128k RAM disk ;BUFBAS = (0xDA00) ; Buffer base with 128k RAM disk ;RDBAS = (0xDE00) ; Start segment of 128k RAM disk ;RDLEN = (0x2000) ; length in paragraphs of 128k RAM disk ; ;RAMBUL = (0xB9B0) ; Top of TPA with 256k RAM disk ;BUFBAS = (0xBA00) ; Buffer b?8)ase with 256k RAM disk ;RDBAS = (0xBE00) 3; Start segment of 256k RAM disk ;RDLEN = (0x4000) ; Length in paragraphs of 256k RAM disk ; ;RAMBUL = (0x99B0) ; Top of TPA with 384k RAM disk ;BUFBAS = (0x9A00) ; Buffer base with 384k RAM disk ;RDBAS = (0x9E00) 3; Start segment of 384k RAM disk ;RDLEN = (0x6000) ; Length in paragraphs of 384k RAM disk ; ;RAMBUL = (0x79B0) ; Top of TPA with 512k RAM disk ;BUFBAS = (0x7A00) ; Buffer base with 512k RAM disk?R ;RDBAS = (0x7E00) 3; Start segment of 512k RAM disk ;RDLEN = (0x8000) ; Length in paragraphs of 512k RAM disk ; ; ; ROM starts at 0xFE000, which is the effective end of memory ; ;* Remote Disks are all on the master, via Circuit 1 ; DSKAST = 0x80,(0x0100),0x81,(0x0100),0x82,(0x0100),0x83,(0x0100)  90x84,(0x0100),0x85,(0x0100),0x86,(0x0100),0x87,(0x0100)  90x88,(0x0100),0x89,(0x0100),0x8A,(0x0100),0x8B,(0x0100)  -0x8C,(0x0100),0x8D,(0x0100),0x8E,(0x0100),0x8?oF,(0x0100) ; ; If using a TurboDOS RAM Disk, the RAM Disk must be mapped into the Disk ; Assignment Table. ; ; 0x00,(DSKDRA) ; Substitute this value into the drive position ; ; you wish the RAM Disk to reside. ; ; NOTE: When using the TurboDOS RAM Disk, DO NOT use Turbogen to modify ; the memory, buffer, or disk parameters. ; ; See the section below for additional RAM Disk installation parameters. ; ; ===?г== ; ; TurboDOS RAM Disk ; ; You must have at least 512k of memory on the Slave Processor to use ; the TurboDOS RAM Disk. ; ; To use RAM disk, enable the following patches, and choose the ; appropriate memory and RAM disk size in t"he memory section. ; ;BUFSIZ = 6 # ; use 8k byte buffers ;NMBUFS = 2 & ; use two buffers ;BUFLEN = (0x0400) '; memory for 16k worth of buffers ; ;!===?=== ; MISCELLANEOUS ;&== ; COMPAT = 0xB0 ; File Access: Permissive, global-write, mixed mode CPMVER = 0x31 ; CP/M BDOS version returned by C-fnc 12 SRHDRV = 0xFF ; Search drive for command files = system disk ; ;&== ; PATCHES ;&== ?x; ; Patch 1.43-01 ; ; The following patch is applicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fcn 15 opening the ; files $.DIR or $.DSK when FCB byte 32 is FF. The ; 'PATCH' module must be included during system generation. ; ;OPNFIL + 0x4A = [PATCH] ;PATCH = 0xE8, [CKSPFN], 0xB0, 0x00, 0x74, 0x03, 0xE9, [OCECOM], ; ,0x83, 0xC4, 0x02, 0xE9, [OPNFIL + 0x59] ; ??  ??BUnit8Data CodeLOKFILGETS1ALDIRGETFXAFREFILCPYFCB GETS2A GETABS CQMCOM BUFMGR BUFMGNGETCRAGETRCAGETXDRUPDAFPCKFCBWLDDRGETF5AGETFDCKDRVLDSKERRERRXITSELDRVCALCBVROVECTDLSTBL2 CKDROMAKEXTF CKFRO@CKSPFIfFNDDDEMGETDENzWRITDE4CKSPFNOPNEXT9OCECOMFNDDE_OPNCOM) GETEXMW GETMMBUPDC?OMCLSEXTKSRHNIT FNDDEC CHKHDSFNDNDE ADVDNOCGETDEA GETDLSRDRECCRDRECGETBLKWRRECCWRRECH GETBLMCHKALVGETABAT GETNABqCLROTEFLOADC,SELFCBLSELDSKRESBIT ZERODNALVNIT" GETLSA GETAVL SAVEDM GETABN OSMCOM "&*.2DIRDSK / rv\UD] 8 uk -td|ou\ Cu{ ڊDn& t0ڈC?ڋ\UC D]&C$ڈC0CB&ڈC0 C&P  X:G rG G  &0PX t4t,Q | Yu  u u 0PXÈ @ $&" & tuS &'CC&CS &C[ ZSt\\K9[r&C  t&7CIB0SZ&:ru ڊ&0 TUBC ؋l]BCڎD]&'CBڊ&CBRSBC ؋l][Z0&ti _tS\UD] fu?:Q T uG CrB YS؎ J[u4S ˉڋ\UˋD]&&g[:G rg P&'0PX & tƄ Í DnCڋ\UC D]\s GETAVL?GETNAB@GETXDRACALCBVBCKOPNDCCKDRVLDDSKMGRECKDROFGETLSAGZERODNHALVNITIADVDNOJCLSFPKCRFCBPLGETDLSMFNDNDENFNDDDEROVECTOFFCN OPNFILCFFCNCLSFIL SFFFCNSNFFCNDFFCNDELFILCRSFFCNWSFFCNMFFCNMAKFILRFFCN CQMCOMSFAFCNHCKLEXTcRDRANDhRRFFCNWRRANDWRFFCN@CKLERRCFSFCNCFSFILSRRFCNKLFFCNNRAVFCNRDPFCNSRSFCN RDMFCN& RDDFCN  DOÈ u|t# PtKufu:\UD]&G t- u# &u u4 G &0Ê $<t tDnt& u P uXDOuL &@tCS [&&o&guŀt"QYt DnP tDn  XDn0@ËDUDz -t yËDzDUD|DoD~Dq uDOS\UD]&$GETAVL?GETNAB@GETXDRACALCBVBCKOPNDCCKDRVLDDSKMGRECKDROFGETLSAGZERODNHALVNITIADVDNOJCL@SFPKCRFCBPLGETDLSMFNDNDENFNDDDEROVECTOFFCN OPNFILCFFCNCLSFIL SFFFCNSNFFCNDFFCNDELFILCRSFFCNWSFFCNMFFCNMAKFILRFFCN CQMCOMSFAFCNHCKLEXTcRDRANDhRRFFCNWRRANDWRFFCNCKLERRCFSFCNCFSFILSRRFCNKLFFCNNRAVFCNRDPFCNSRSFCN RDMFCN& RDDFCN  DOÈ u|t# PtKuf@xu:\UD]&G t- u# &u u4 G &0Ê $<t tDnt& u P uXDOuL &@tCS [&&o&guŀt"QYt DnP tDn  XDn0ËDUDz -t yËDzDUD|DoD~Dq uDOS\UD]&$u4 G uϰ'@ & &'9t M:t& YLn   P xXt\\L0 0à :ruKK :ru CCC :rÊ KK CCC  &&CC&7Lj$$ňŜ $ C&C&/C&;< rBR=>rFu?uZTU\\QDDSDDO<DDQDDUDDSDDOÊDU@A` DVt'RSDUB[ZuLVu !Ӊ`ÈDO Ӊ`ðt@ ȈSDUDDCtD[É\Q<ErFrGHDO<G u4 G uϰ' & &'9t M:t& YLn   P xXt\\L0 0à :ruKK :ru CCC :rÊ KK CCC  &&CC&7Lj$$ňŜ $ C&C&/C&Ac;< rBR=>rFu?uZTU\\QDDSDDO<DDQDDUDDSDDOÊDU@A` DVt'RSDUB[ZuLVu !Ӊ`ÈDO Ӊ`ðtȈSDUDDCtD[É\Q<ErFrGHDO<G DPFCN?AMFCN@DMFCNASMFCNBRMFCNCSESFCNDSERFACNESDTFCNFRDTFCNGRDMFCNHROUFCNISCFFCNJLOGFCNKLFFCNLADFFCNMALDFCNNSCLFCNORAVFCNPRDPFCNQSRSFCNRPDAFCNSSBPFCNTRBPFCNULFDFCNVFFBFCNWSRPFCNXEOPFCNYSRDFCNZQPFFCN[FLBFCN\RCFCN]CCSFCN^CCIFCN_CCOFCN`SCBFCNaRCBFCNbSMCFCNcRMCFCNdEXTFCNeRDDFCNfTOFFCNgTMFFCNhTLRFCNiTFRFCNjSFLFCNkRFLFCN;lCodemDISDSPnSETDR1oCKATATNpENADSPqGETSDSrGETWSBsNETREQtPFNFCNuDT3FCNvMPMFCNwTSTUNDlOCNTRY lOTNTRY#lXCNTRY0lXTNTRYlERRXIT``````` ` ` ` ` ```````````````` ``` `!`"`#`$`%`&`!#` '`(`)` *`+`",`-`.`/`0`1`2`3`4`5`6` 7`8` 9`:`;`<`=`>`?`@`AVA`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[` \`]`^`_```a`b`c`d`e` f`g`h`i`j`k`l    damno u    tOtQtStUtWtYt[t]t_ i <D_D]D[DYDWDUDSDQDO t ËdaDO DetPpD_t]l[|YtWTULS\QDO t^qVrƉ\QLSTUDW|Yl[D]D_A DO srKDS u`<2%`t)r(WSZڄuWO QR [ZYY`(u`x 5`D&u !``ՊD( ȈD0D( D( tuv u  D0u/D/@u)\(S` 0)Ӊ\(r {B[\(t {y5``9t T1 A 2L` \1 U y\1W` 9Ӊu t w  -@t  t kt  ! l mtD t \1G_t0D&t\+D-T+l-D&tڕ D&t @KD0:rD( D0D(   CD(CD)CD*C`D/tD0C' :DU$` DV<s` `&`DQÊDU tÊDU lV t  Ӊ`` t S [u ` 9trӉ\1t:Ouŀu B uP xG u @t2Q %t uY   @ Y@tQ gY u t w\1 ttAŀt<t$`<`u/Q `ˋtSQ Y[Du `Y` ` 9t Ӏ'߉tuË`Q Yŀt Q Y0û` ` 09tS [t\1Ãd' D'V D':uFC0^d'uD0:r u D/tD À'  tJD$`:Ds u tu % _ VCDF^\1BpGD"GD 0 / \1 `\1`   uú    \1ÊD' ` ` 9DSKMGROriginBUnit2Data?CodeDSKASTLDIRSHL7BXDSKERRERRXITTSTUNDDSTPTDSKNITBPDAFCNSELDRVDSKMGRGETXDR `1 QS`ˉ``` ڊ:uBCB['KYyB\U D]B t6T DD DOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r u u ;ËL$IDxAL\$\TDdx\ǀuڹ A)syIAx )sڋ\ˋL D"D L \TڋLˇڋ \)s,Sˉ\ Q ZuH\ LډӉ\ 7 \C뻊D\T0)s؎ otD  ttDx\ÊD$¶` Ӌu%S *uD t`t  w0`á`  t4`  t-```W ` 1 _``À>`t [W| V1^_À>`t 9W1Vt ^_À>`u ` DðÀ>`uððËTTL ` ‹Ld[}! "" BBRLCLUSROriginBUnitDataCodeCRPROCCLBNITSYSDATDBCFCNOTNTRYOCNTRY SETDR2 DSPIFR TSTUND USRSOM SYSDSKSPLDRVPRTMODQUEPTRCOLDLDSUBMITWARMLDCMDINTBASPAGCLSAQPAUTLOGWSRESCONSTATNCHRXFRCDCOLCNTLOGUSRCKDOSTCKBMST CIRES!LCLDES"GETSDS#GETWSBDSKSAVUSRSAVGSX86COLDSTLCLNITFCINTRYBi*WARMSTCLRCDCcTurboDOS 1.43, Copyright 1986, Software 2000, Inc. $($/$)$( `0.`.&`.`.&` .`.&` τt2ut6u .` t.`uV C.` ^1.`u.&`.`.&` Dg 0 `` $n`c G  tRS` 5[ ` +[ ` ! ` tB- . ```u.` `` u؎ڱ3 .` U.` .` 0 \,`` :@u tVtXtNtP<t,tBt``t b`R 5[CuC`  ` ` u ``'< u `/< u CCMCD`5t`3 `,`2`& t `F`&; @u ` ` `J   $ ?t *t`J  /t t`Z `o` % rڈCځ`r  sSC`r[K`n`n ػ`J.` \  `&x``5t B `3 K`` s  `N`&u#`t` u±>`u  0DS \UD]&&_S Z` SDU &< uCڻ`S P[   C CCC,SLVRESDataCodeSLRCHRSLVRES:`t``ux17 ;ETB ACAN: equ byte 0x1 rv\UD] 8 uk -td|ou\ Cu{ ڊDn& t0ڈCڋ\UC D]&C$ڈC0CB&ڈC0 C&P  X:G rG G  &0PX t4t,Q | Yu  u u 0PXÈ @ $&" & tuS &'CC&CS &CCCCCSPB124CodeLAD124LEN124SPB124$SID124!DID124+SSL124"@&Ȏ؎м      .@t0  @t  $Ժ   0 n   $ "  . t $  P0 & IlX< t) 1>  @>      "  [     "  1؉ E:@   CC  CCC;&== ; ; STDSINGL.GEN TurboDOS v1.43+ f03 Feb 1987 ; ; These modules support a single user system on the model 1230 processor ; CNFTBL b ; Configuration table STDSINGL ; Modules for a single-user system without spooling CPMSUP ! ; CP/M Function Support ;MPMSUP ; MP/M Function Support ;QUEMGR '; MP/M queuing function support USRSOM $ ; User Sign-On Message area, filledCH by STDSINGL.PAR NIT186 ? ; Cold-start initialization, particularly hardware init XTISR /; Interrupt Sorter for Model 1230 board MEMTBL ' ; TurboDOS memory fragment tables RTC ; Real-time-clock driver CONSOL  ; Terminal handler ;SUBMIT 5; To emulate CP/M processing of $$$.SUB files USRSUP / ; To handle more than one USRFCN module PATCH ; Software 2000 Patch Area ; ;%===Cp= ; ; SERIAL I/O CONTROLLERS ; If you don't have any Model 1250 I/O boards, choose SET ONE. ; With SET ONE, you can choose CONSOL and 1 printer. ; If you have one or more I/O boards, choose SET TWO. With SET TWO, you ; can choose as many device!s as you have serial ports. ; ;&== ; Set One ; ;XS3040 9; I/O driver 1230 SCC ports only ; ; Set Two ; XTSER ; Serial I/O handler: must bCe present XTSCC -; Serial driver for Model 1230 ports XTS1250 *; Serial driver for Model 1250 ports ; ;&== ; ; PRINTER SELECTION ; How many printers you can choose depends upon how many serial ports you ; have available. Which drivers you choose depends upon your printers. ; Note: CTS and XON/XOFF are handled by the serial driver patches in the ; .PAR file ; ;==CX== ; LSTETX ! ; ETX/ACK Serial Printer LSTCNT $ ; Centronics Parallel Printer ; ;&== ; ; DISKS ; ; LFT supports three standard configurations: ; ; A. Floppies ; B. DMA winchesters (C01100 controller). ; C. RAM disk ; ; Choose one of the sets below accordingly. ; ; NOTE: TURBOGEN expects that "DSKDRA" is the floppy driver, and "DSKDRB" ; CPI is a winchester driver. If you want to use TURBOGEN, DO NOT change ; - the order of the modules listed below. ; ;&== ; ; A. Floppies ; FD930 u; Modules needed to run a Model 930 Floppy controller ; ; B. DMA winchester also choose A for floppies ; DW1100 ; Model C01100 controller (DMA) ; ; C. TurboDOS RAM Disk ; ;MDISK ; Module needed for TurboDOS RAM Disk Support ; ; NOTE: When CW(O( >!0F>_(˯@!0p#:0 (!0[0S00+~!(1^#V#N#F +*0"(1    @   DDDD}SPB186CodeLAD186LEN186SPB186SID186DID186SSL186"@ Ȏ؎м 1ػ 8 O < U  = T 6 < t > > ʋ 1؉ E rSì  RP . $tXZR . $ tZPR . $t " ZX   GDDD  D"DA]*rs and working storage OSMTOP = (0x0000) ; Absolute top paragraph ; ;&== ; DISKS ;&== ; ; If you change BUFSIZ & NMBUFS, change RAMBUL, TRKBUF, BUFBAS, and BUFLEN ; to reflect the new buffer requirements ; BUFSIZ = 6 * ; Disk buffer size = 8K bytes NMBUFS = 4 / ; # disk buffers allocated at cold-start (4) DBUFLEN = (0x800) 0 ; Number of paragraphs in BUFBAS ; SRT431 = 3 5 ; 6 msec step rate for Shugart 5" drives SRT401 = 8 ~ ; 8 msec step rate for Shugart 8" drives ; ; Disk Assignment Table ; DSKAST = 0x00,(DSKDRA) ; Drive A = floppies  0x01,(DSKDRA) ; B  0x02,(DSKDRA) ; C  0x03,(DSKDRA) ; D  0x04,(DSKDRA) ; E  0x05,(DSKDRA) ; F  0x06,(DSKDRA) D ; G  0x07,(DSKDRA) ; H ; ; Choose one of the next two Sets depending upon whether you have a ; Winchester controller. ; ; SET ONE: choose this set if you do not have a winchester. ; 6 0xFF,(0x0000) ; Drive I is not in the system ; 6 0xFF,(0x0000) ; Drive J is not in the system ; 6 0xFF,(0x0000) ; Drive K is not in the system ; 6 0xFF,(0x0000) ; Drive L is not in the system ; & 0xFF,(0x0000) ; Drive M is not Din the system ; 6 0xFF,(0x0000) ; Drive N is not in the system ; 6 0xFF,(0x0000) ; Drive O is not in the system ; 0xFF,(0x0000) ; Drive P is not in the system ; ; SET TWO: choose this set if you have a 1100 DMA winchester controller. ;  00x00,(DSKDRB) ; Drive I = DMA winchester  0x01,(DSKDRB) ; J  0x02,(DSKDRB) ; K  0x03,(DSKDRB) ; L  0x04,(DSKDRB) ; M   D 0x05,(DSKDRB) ; N  0x06,(DSKDRB) ; O  0x07,(DSKDRB) ; P ; ; If using a TurboDOS RAM Disk, the RAM Disk must be mapped into the Disk ; Assignment Table. ; ; 0x00,(DSKDRC) ; Substitute this value into the drive position ; ; you wish the RAM Disk to reside. O ; ; NOTE: When using the TurboDOS RAM disk, DO NOT use Turbogen to modify ; -the memory, buffer, or disk parameters. ; ;==D?=== ; MISCELLANEOUS ;&== ; COMPAT = 0xB0 B; File Access: Permissive, global-write, mixed mode CPMVER = 0x31 7; CP/M BDOS version returned by C-fnc 12 SRHDRV = 0xFF >; Search drive for command files = system disk JDATE = 0x3639 ' ; Cold-start date = Jan 01, 1986 ; ;&== ; D PATCHES ;&== ; ; Patch 1.43-01 ; ; The following patch is applicable to all 8086 TurboDOS ; systems, version 1.43, containing the module 'FILMGR'. ; This patch corrects problems with C-fcn 15 opening the ; files $.DIR or $.DSK when FCB byte 32 is FF. The ; 'PATCH' module must be included during system generation. ; OPNFIL + 0x4A = [PATCH] PATCH = 0xE8, [CKSPFN], 0xB0, 0x00, 0x74, 0x03, 0xE9, [OCECOM],  0x83,DD5' 0xC4, 0x02, 0xE9, [OPNFIL + 0x59] ; ,D  E G^! " >&>&>&>&>&>%>' !>0%>ͷ ! F͞ ! ͮ w#Gͦ : (! [ S +~![ ^#V#N#F +* "$o > ͮ M~#ͷ$ ͮ w#$w O$o y [ D R . $t " ZX   B u u 0PXÈ @ $&" &5 tuS &'CC&CS &CEEEESPD186nDataCodeALLOCWAITLNKPOLUNLINKSIGNALGETSDS SLVRES ATNCHR.S0IBSZJS1IBSZSPINITgCOMDRVgSERIALfFIV5W~^>8. @a:: a@@!`%aVV a\\!`悰 悰悰悰D悰悰悰悰悰悰悰悰 悰悰 悰 悰R悰 悰 悰 悰悰悰怰D怰怰怰怰怰怰怰怰 怰怰 怰怰 R怰 怰 怰 怰怰E怰怰悰悰悰悰悰怰怰怰怰怰悰悰悰悰悰 悰 悰怰怰怰怰 怰 1ػ 0`O  8`.`0`2`4`J`L`N`Pg u s `á`6`4t`R`PtÄu8`6t$`6`4Cڋ`.K`0 )sʉ`4`f`8`Rt$`R`PCڋ`JK`L )sʉ`P`j`T Ȅu$t`h$@t$ t憰$t`l$@t$ t愰ÄuE]($t`h$@t$ tÈ`g`D`>$t`l$@t$ tÈ`k```Z$t`h $@t$ t`g憻`D`>$t`l $@t$ t`k愻```ZPSQR  " ZY[X䂨t{悐䂨`t 0悐 f`h u]`ht `8u `2`4`6 `.`6B)r.`6`2Cڋ`.K`0 )sʉ`2`f`8 䀨t{怐䀨`t 0怐 f`l u]`lt E9 `8u `N`P`R `J`RB)r.`R`NCڋ`JK`L )sʉ`N`j`T   Êtû`h t`l  $`Ë û`ht`lú `it `m'}t@*t̀'ú t $+@E D;&== ; ; STDLOADR.GEN TurboDOS v1.43+ g 23 Dec 1986 ; ; These are the modules used in the operating system intermediate loader ; CNFLOD L ; Configuration table STDLOADR ; Modules for a simple loader NIT186 , ; Cold-start hardware initialization XTISR ; Interrupt service ;CONSOL 3; Console driver if loader sign-on desired ;XS3040 ; Serial Driver RTCNUL  ; No n EES4 = (0x0050) ; Output buffer size = 80. bytes ; ;&== ; SPOOLING ;&== ; PRTMOD = 1 0 ; Default printmode = print spooled QUEPTR = 1 7 ; Default Printer/Queue is Printer/Queue A EOPCHR = 0 b ; A "null" in the print stream will terminate printing. ; ;* Dispatch Table ; DSPPAT = 0x01 ; Printer AE will be fed from Queue A ;  0x02 9 ; If you have a second printer, assign Queue B to it. ;  0x03 8 ; If you have a third printer, assign Queue C to it. ;  0x04 ; If you have a fourth printer, assign Queue D to it. ; ; the rest of the printers feed from Queue A ; ;* Queue Assignment Table ; QUEAST = 0x00,(0x0000) ; Queue A is local  A0xFF,(0x0000) ; Terminate the table with an "undefined" queue ; 0x00,(0x0000) ; Queue B is locEeal ; & 0x00,(0x0000) ; Queue C is local ; 5 0x00,(0x0000) ; Queue D is local ; SPLDRV = 0xFF *; Default Spool Drive is system disk ; ;&== ; PHYSICAL CONFIGURATION ;&== ; ;* Memory - choose the values of RAMBUL and TRKBUF according to the amount ; of memory in your system. All values are paragraph (segment) valuEes. ; ; If you wish to have a RAM disk, choose the sub-set for your ; memory size and RAM disk size. Note that RAM disk is not supported ; on masters with less than 512k bytes of memory ; ; SET ONE - for 256K bytes ; RAMBUL = (0x33C0) :; Top of TPA (No RAM disk recommended) TRKBUF = (0x3C00) (; Floppy Track Buffer BUFBAS = (0x3400) ; Start of External Buffer Area ; ; SET TWO - for 512K bytes ; ;RAMBUL = (0x73C0) ; Top of TPA with no RAM disk ;TRKBUF = (0x7C0E0) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0x7400) ; Start of External Buffer Area with no RAM disk ; ;RAMBUL = (0x53C0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0x5C00) ; Floppy Track Buffer with 128k RAM disk ;BUFBAS = (0x5400) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0x6000) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0x33C0) ; Top of TPA with 256k RAM Edisk ;TRKBUF = (0x3C00) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0x3400) ; Start of External Buffer Area with 256k RAM disk ;RDBAS = (0x4000) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ; SET THREE - for 1024K bytes (one megabyte) ; ;RAMBUL = (0xEFC0) ; Top of TPA with no RAM disk ;TRKBUF = (0xF800) ; Floppy Track Buffer with no RAM disk ;BUFBAS = (0xF000) ; Start of External Buffer Area witEh no RAM disk ; ;RAMBUL = (0xCFC0) ; Top of TPA with 128k RAM disk ;TRKBUF = (0xD800) ; Floppy Track Buffer with 128k RAM disk ;BUFBAS = (0xD000) ; Start of External Buffer Area with 128k RAM disk ;RDBAS = (0xDC00) ; Base of RAM disk with 128k RAM disk ;RDLEN = (0x2000) ; Size of RAM disk with 128k RAM disk ; ;RAMBUL = (0xAFC0) ; Top of TPA with 256k RAM disk ;TRKBUF = (0xB800) ; Floppy Track Buffer with 256k RAM disk ;BUFBAS = (0xB000) ; Start of EExternal Buffer Area with 256k RAM disk ;RDBAS = (0xBC00) ; Base of RAM disk with 256k RAM disk ;RDLEN = (0x4000) ; Size of RAM disk with 256k RAM disk ; ;RAMBUL = (0x8FC0) ; Top of TPA with 384k RAM disk ;TRKBUF = (0x9800) ; Floppy Track Buffer with 384k RAM disk ;BUFBAS = (0x9000) ; Start of External Buffer Area with 384k RAM disk ;RDBAS = (0x9C00) ; Base of RAM disk with 384k RAM disk ;RDLEN = (0x6000) ; Size of RAM disk with 384k RAM disk ; ;RAMBULE  = (0x6FC0) ; Top of TPA with 512k RAM disk ;TRKBUF = (0x7800) ; Floppy Track Buffer with 512k RAM disk ;BUFBAS = (0x7000) ; Start of External Buffer Area with 512k RAM disk ;RDBAS = (0x7C00) ; Base of RAM disk with 512k RAM disk ;RDLEN = (0x8000) ; Size of RAM disk with 512k RAM disk ; ; ; ROM starts at 0xFC000, which is the effective end of memory ; ; IF YOU PLAN TO USE TURBOGEN, DO NOT CHANGE OSMLEN & OSMTOP ; OSMLEN = (0x1000) ; Reserved memory for buffe FF9eed for a clock handler PATCH ! ; Software 2000 Patch Area ; ;&== ; DISKS ; ; The modules we supply allow you to choose one of 2 configurations: ; ; A. Floppies only. ; B. DMA winchesters (C01100 controller). ; ; Choose one of the sets below accordingly. ; ; NOTE: The order of the driver modules determines the name of the ; Ddriver entry point. For example, if you have Floppies and ; FiC a Winchester, the Floppy Driver (for both 8" and 5") will ; 9be DSKDRA, and the Winchester Driver will be DSKDRB. ;&== ; ; A. Floppies ; FD930 s; Model 930 DMA floppy controller support ; ; B. DMA winchester also choose A to enable floppies ; DW1100 . ; Model 1100 DMA winchester controller ; ;&== ; USER-WRIFG3TTEN DRIVERS ; If you have any, add them here. ;&== ?RSHL7BXDSKERRERRXITTSTUNDDSTPTDSKNITBPDAFCNSELDRVDSKMGRGETXDR `1 QS`ˉ``` ڊ:uBCB['KYyB\U D]F8DOSLOADOriginBUnitDataCodeRESUMEOTNTRYOCNTRYMSG001MSG002TSTUND USRSOM MSG004 MSG003 EndData HDWNITCRPROCDSKNITBMINITLOADFN SCANDNLODSEG9SYSDAT)LDRDMSALLOCDEALOC OSMASTERSYS" @COPYRIGHT 1986, SOFTWARE 2000, INC. (VERSION 02/05/86) ".`9Ȏ؎м` Dg`C  Or o.`.`=`yF..`; RZy    <t< u 0 뫉&` ``uW` t± u B  sK &` `u:` ty<r    g >u  ðú`?V`` ؎ t \`< t < t ^  Copyright 1986, Software 2000, Inc. t(RS l([  c/[  Z) `tڱ  E F `  4: .` SQ $Y[r&&:u C@  ] r ,û` uڱ3`7`uû``)0` C``ú`à`yA :`   q.  C$ to retry not found, bad memory loading at , unexpected end-of-fileOSNTRYOriginBUnitDataCLOFCNCIFCNCOFCNRCIFCNRCOFCNLOFCNDCFCN RIBFCN SIBFCN PBFCN CFIBFCN CSFCNRVNFCNRDSFCNSELFCNOFFCNCFFCNSFFFCNSNFFCNDFFCNRSFFCNWSFFCNMFFCNRFFCNRLIFCNRCDFCNSDFCNWPDFCNRROFCNSFAFCN DPBFCN!SRUFCN"RRFFCN#WRFFCN$CFSFCN%SRRFCN&RDFCN'LKRFCN(FRRFCN)SSCFCN*DFSFCN+CHNFCN,SDBFCN-RDBFCN.RRMFCN/RAMFCN0ARMFCN1AAMFCN2FMSFCN3FAMFCN4PLFCN5DT1FCN6DT2FCN7RSNFCNF 8SRCFCN9SRTFCN:PBCFCN;PBLFCN<ROSFCN=CTPFCN>DPFCN?AMFCN@DMFCNASMFCNBRMFCNCSESFCNDSERFCNESDTFCNFRDTFCNGRDMFCNHROUFCNISCFFCNJLOGFCNKLFFCNLADFFCNMALDFCNNSCLFCNORAVFCNPRDPFCNQSRSFCNRPDAFCNSSBPFCNTRBPFCNULFDFCNVFFBFCNWSRPFCNXEOPFCNYSRDFCNZQPFFCN[FLBFCN\RCFCN]CCSFCN^CCIFCN_CCOFCN`SCBFCNaRCBFCNbSMCFCN F0F' x7 = 1200 baud xE = 9600 baud xF = 19200 baud ; ;CONAST = 0,(CONDRA) ; Console Channel # & driver entry point ; ; Choose the next two parameters if you have a "no protocol" terminal. ; ;CONBR = 0x8E 7 ; Console = 9600 baud, no protocol ;SDCB0+0x10 = 0x64 ; DTR high, bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have a CTS terminal. ; ;CONBR = 0xCE A; Console = 9600 baud, CTS ;SDCB0+0x10 = 0x64 ; DTR high, F}bits-per-char = 8, protocol enabled ; ; Choose the next two parameters if you have an XON/XOFF terminal. ; ;CONBR = 0x9E ; Console = 9600 baud, XON/XOFF ;SDCB0+0x10 = 0x60 ; DTR high, bits-per-char = 8, protocol enabled ; ;* Buffer Parameters ; ;SDCB0+0x19 = (0x0050) ; Input buffer size = 80. bytes ;SDCB0+0x2F = (0x0050) ; Output buffer size = 80. bytes ;xSDCB0+0x1D = (0x0005) ; "Start Receive" threshold: send XON or raise CTS ;SDCB0+0x1F = (0x0045) ; "Stop Receive" F]q&threshold: send XOFF or drop CTS ; ;&== ; PRINTERS ;&== ; ; LFT supports 3 configurations of serial devices. Each of ; these configurations starts with the two serial ports on the Model 1230 ; board (Channels 0 and 1). Usually, Channel 0 is the terminal. The other ; configurations depend upon you'r mixture of Serial Boards. ; ; If yFcou have: % Set NMBSER to: ; ; A. 1230 only:  2 serial devices: 2 ; B. 1230 + 1250:  8 serial devices: 28 ; C. 1230 + 1250 + 1250: 14 serial devices: 14 ; ;* Number of Serial Channels to be serviced ; ; Set NMBSER equal to the number of channels indicated by the configuration ; you chose above. ; NMBSER = 2 G; Configuration A ; ; ;* Printer Assignment Table: per order in STDMFhASTR.GEN ; ; This table assigns a driver to each Channel in your configuration. Which ; driver is "LSTDRA" depends upon which one is listed first in STDMASTR.GEN. ; ; The assignments for Channels 2 and 3 are commented out and are meant to ; serve as an example in case you need to add more drivers. ; To use two parallel printers, use the second set of instructions. ; PTRAST = 0x01,(SERIAL) ; Printer A = Channel 1, CTS printer 0xFF,(0000) ;Terminate the table with an "undefinFed" printer ; 4 0x02,(SERIAL) ; Printer B = Channel 2, XON/XOFF ; 3 0x03,(LSTDRA) ; Printer C = Channel 3, ETX/ACK ; 0x11,(LSTDRB) ; Printer D = centronics parallel printer (LSTCNT) ; ; To use two parallel printers, enable the following two patches. ; When using this patch, however, TurboGEN must NOT be used. ; ; E 0x00,(LSTDRB) ; Printer D = centronics parallel printer (LSTCNT) ; R 0x01,(LSTDRB) ; Printer E = centronics parallel printer (LSTCNT) ; ;* Driver PFoatch Points ; ETXBR = 0x0E B; ETX/ACK driver: Protocol = none, Baud rate = 9600 ETXLEN = 0x8C -; # fill characters for ETX (140) ETXSEQ = 3 / ; Length of ETX escape sequence ETXFF = 0x0C 3; ^L Formfeed for ETX/ACK printer ; CNTFF = 0x0C ; ^L Formfeed for centronics parallel printer ; ;* Channel Patch Points ; ; The patch points for Channels 2 and 3 are commented out and are meant to ; serve as an example in case you need to add more driveF Zrs. ; ; Channel 1, in the default configuration, is a CTS printer ; SDCB1+0x0F = 0x6E 3; CTS, Input Disabled, 9600 baud SDCB1+0x10 = 0x64 @; DTR high, 8 bits-per-char, protocol enabled SDCB1+0x16 = 0x0C ; ^L End-of-print character = Formfeed SDCB1+0x19 = (0x0005) ; Input buffer size 5 characters SDCB1+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 2, in the example, is an XON printer ; ;SDCB2+0x0F = 0x1E ; XON, Input Enabled, 9600 baud ;SDCB2+0x10 F = 0x64 ; DTR high, 8 bits-per-char, protocol enabled ;SDCB2+0x16 = 0x0C ; ^L End-of-print character = Formfeed ;SDCB2+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB2+0x2F = (0x0050) ; Output buffer size = 80. bytes ; ; Channel 3, in the example, is an ETX/ACK printer ; ;SDCB3+0x0F = 0x0E ; No protocol, Input Enabled, 9600 baud ;SDCB3+0x10 = 0x60 ; DTR high, 8 bits-per-char, protocol disabled ;SDCB3+0x19 = (0x0005) ; Input buffer size 5 characters ;SDCB3+0x2F G.GcRMCFCNdEXTFCNeRDDFCNfTOFFCNgTMFFCNhTLRFCNiTFRFCNjSFLFCNkRFLFCN;lCodemDISDSPnSETDR1oCKATTNpENADSPqGETSDSrGETWSBsNETREQtPFNFCNuDT3FCNvMPMFCNwTSTUNDlOCNTRY lOTNTRY#lXCNTRY0lXTNTRYlERRXIT``````` ` ` ` ` ```````````````` ``` `!`"`#`$`%`&`!#` GW'`(`)` *`+`",`-`.`/`0`1`2`3`4`5`6` 7`8` 9`:`;`<`=`>`?`@`A`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[` \`]`^`_```a`b`c`d`e` f`g`h`i`j`k`l    damno u    tOtQtStUtWtYt[t]t_ i <D_D]GD[DYDWDUDSDQDO t ËdaDO DetPpD_t]l[|YtWTULS\QDO t^qVrƉ\QLSTUDW|Yl[D]D_DO srKDS u`<2%GETAVL?GETNAB@GETXDRACALCBVBCKOPNDCCKDRVLDDSKMGRECKDROFGETLSAGZERODNHALVNITIADVDNOJCLSFPKCRFCBPLGETDLSMFNDNDENFNDDDEROVECTOFFCN OPNFILCFFCNCLSFIL SFFFCNSNFFCNDFFCNDELFILCRSFFCNWSFFCNMFFCNMAKFILRFFCN CQMCOMSFAFCNHCKLEXTcRDRANDhRRFFCNWRRANDWRFFCNCKLERRCFSFCNCFSFILSRRFCNKLFFCNNGRAVFCNRDPFCNSRSFCN RDMFCN& RDDFCN  DOÈ u|t# PtKufu:\UD]&G t- u# &u u4 G &0Ê $<t tDnt& u P uXDOuL &@tCS [&&o&guŀt"QYt DnP tDn  XDn0ËDUDz -t yËDzDUD|DoD~Dq uDOGyS\UD]&$u4 G uϰ' & &'9t M:t& YLn   P xXt\\L0 0à :ruKK :ru CCC :rÊ KK CCC  &&CC&7Lj$$ňŜ $ C&C&/C&;< rBR=>rFuH?uZTU\\QDDSDDO<DDQDDUDDSDDOÊDU@A` DVt'RSDUB[ZuLVu !Ӊ`ÈDO Ӊ`ðtȈSDUDDCtD[É\Q<ErFrGHDO<G   9DS TUT]`> Gt ;r9r DOà`PG` >`ju(`> Gt`H:Gs SQ LY[G X` o rKOGG`7wG)OSڻ`> ^[G `P`ڻ` BX`DOX`û`> $` ```RQ` YZù (C` t/`:Gu2G;tG;u  )ËGGá`u`⻋`t`GڋOډOU ]``f`  uډ wr0G+Gs/>`t؀>``u;`s``⺠``t>``u` û`>`Hf `:Gs rtËG t)ڋ+r PGQڋ)Ys ;Gr9X ڕ\UD]`fݹ ``COMSUBOriginBUnitDataCodeCONOUTSYSDATUndDataUndCodeTSTUND DEXLAT0SHL7BX7DECOUTuUNLINKLNKENDLNKBEGDMSDMSBXUPRCASCALCBVLDIRLDDRGETSDS!00`ù Cty$8u ;uCC QYô '    H0d ĺ )sӄut 0PS[XËGډGË_OW ډO[  .CtS[`t)r(WSZڄuWO QR [ZYY`(u`x 5`D&u !``ՊD( ȈD0D( D( tuv u  D0u/D/@u)\(S` 0)Ӊ\(r {[\(t {y5``9t T1 A 2L` \1 U y\1W` 9Ӊu t w  -@t  t kt  ! l mtD t \1G_tIZ0D&t\+D-T+l-D&tڕ D&t @KD0:rD( D0D(   CD(CD)CD*C`D/tD0C' :DU$` DV<s` `&`DQÊDU tÊDU lV t  Ӊ`` t S [u ` 9trӉ\1t:Ouŀu  uP xG u @t2Q %t uY   @ Y@tQ gY u t w\1 ttAŀt<t$`<`u/Q `ˋtSQ Y[Du `I Y` ` 9t Ӏ'߉tuË`Q Yŀt Q Y0û` ` 09tS [t\1Ãd' D'V D':uFC0^d'uD0:r u D/tD À'  tJD$`:Ds u tu % _ VCDF^\1GD"GD 0 / \1 `\1`   uú    \1ÊD' ` ` 9DSKMGR II~YLnYuxϊ ˀ  Ë *tË t DŽ!Ë t DŽ!SPLMSGOriginBUnit^CodeDMSCONSOCONSTCONINICONSIUPRCASSPLERRSpooler error (Ignore, Abort) tPX.`" (` t`DSPCHROriginBUnitVDataICodeXTNTRYDEALOCALLOCLNKENDUNLINKLNKBEG GETSDSTICCNTRDYSPHCTPFCN/CRPROC=GETWSBsSMFCNySNDMSGSIGNALRMFCNRCVMSGWAITLNKPOLISRXITSETDRFDISDSPDSPIFRENADSPDPFCNDELAYRESUMEDLYTIC6GETTOSI DSETDDF"a c T` TUt \Q "DOñ`U@`T P` [ SR ]ZYu5QS ]C[`TGN`TYOD [ [ GF_HW3R` [0ËTQ\US[ \U \Q q_û`PV `U@u  D7@u DL` b %^Xπd7D7@tL7L7@  D7ud7À`U`UuÀ&`U`x0\Ut\8` \L`U@D:\T@lB|DdFTHDJ؎м`T&`U r`` tI7W[`U u# ƻ` \Lx` `U `t ƎDJTHdF|DlBT@L>\`t 9`s` r)+` `uH` û`)G`\U \QDOÉ` )s` ` ` ``tW` @@)t/r9`kr``ڋ`t`= r GË` BB$0Ë` ` BB)Ӱr;`r ` CCW JJOriginBUnit2Data?CodeDSKASTLDIRSHL7BXDSKERRERRXITTSTUNDDSTPTDSKNITBPDAFCNSELDRVDSKMGRGETXDR `1 QS`ˉ``` ڊ:uBCB['KYyB\U D] t6T DD DOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r u u ;ËL$IDxAL\$\TDdx\ǀuڹ A)sJyIAx )sڋ\ˋL D"D L \TڋLˇڋ \)s,Sˉ\ Q ZuH\ LډӉ\ 7 \C뻊D\T0)s؎ otD  ttDx\ÊD$¶` Ӌu%S *uD t DOË\Ut`à`DOË\UD]&O&G&&CIQS 9[Yò :`t & ut` t:`t `t : :`t!: `t: `t: `uڀ J u   tQY Dgtȴ` Ê/_tCONTBLOriginBUnit DataCONDRAATNCHRRESCHRABTCHRECOCHRPRTCHRCONASTATNBEL `DSPSGLOriginBUnitDataCodeLNKBEGALLOCTICCNTLNKPOLDPFCN DELAYWAIT(DLYTICESIGNALJCRPROCoRESUME{ISRXIT|DISDSPGETTOSGETWSB"a"J8`\Uu l``y ] x0``uË`K`tû`0É` SZӉ` S` YCË&` 6`&` SQR``t7W[ZY[á` á`COMSUBOriginBUnitDataCodeCONOUTSYSDATUndDataUndCodeTSTUND DEXLAT0SHL7BX7DECOUTuUNLINKLNKENDLNKBEGDMSDMSBXUPRCASCALCBVLDIRLDDRGETSDS!00J `ù Cty$8u ;uCC QYô '    d ĺ )sӄut 0PS[XËGډGË_OW ډO[  .CtS[ DOË\Ut`à`DOË\UD]&O&G&&CIQS 9[Yò :`t & ut` t:`t `t : :`t!: `t: `t: `uڀ  u   tQY DgtJIȴ` Ê/_tCONTBLOriginBUnit DataCONDRAATNCHRRESCHRABTCHRECOCHRPRTCHRCONASTATNBEL `DOMGROriginBUnit DataCodeXCNTRYSETCBFUNLINKSAVCLBLDIRCLRCLB LNKBEG ALLOC DEALOCDOCONIADFFCN~CKDOSTa!`uFCtjtl\j\lTn R`DnƄ `ZTn DlDj`tGJ *Ê< t<u t `` `  ËDUu Dn`u``t `` Y YuC` ) Ju4` ڌ݋\UD] `G G G$Sڱ[O$t DOÃ`  # ft `S 1[   `t  `t: 5 $tSDnP`DnڱXDn[Ë`Ë``)` ` INPLNOriginBJUnitCodeECHODMSCONINCONOUTINPLN &/C&SC0P <t<< s<t4< t5<t<<t8XP8s&CXP< s@Q^ VY N X[&  uZXtP K&< s  XPRSQR  ZY[SQY[SQY[LSTMGROriginBUnitGCodeEOPCHRSPLOUTCONOISPLEOPCALCBVDSPINPTSTUND PTRASTPBLFCNLSTOUT&SRPFCNEOPFCNLOFCNXFRLD\UD]&O&G&JIQ&CS [YË\UDT tLQS [Yt <sDh`t)r(WSZڄuWO QR [ZYY`(u`x 5`D&u !``ՊD( ȈD0D( D( tuv u  D0u/D/@u)\(S` 0)Ӊ\(r {[\(t {y5``9t T1 A 2L` \1 U y\1W` 9Ӊu t w  -@t  t kt  ! l mtD t K\1G_t0D&t\+D-T+l-D&tڕ D&t @KD0:rD( D0D(   CD(CD)CD*C`D/tD0C' :DU$` DV<s` `&`DQÊDU tÊDU lV t  Ӊ`` t S [u ` 9trӉ\1t:Ouŀu  uP xG u @t2Q %t uY   @ Y@tQ gY u t w\1 ttAŀt<t$`<`u/Q `ˋtSQ Y[Du K%`Y` ` 9t Ӏ'߉tuË`Q Yŀt Q Y0û` ` 09tS [t\1Ãd' D'V D':uFC0^d'uD0:r u D/tD À'  tJD$`:Ds u tu % _ VCDF^\1GD"GD 0 / \1 `\1`   uú    \1ÊD' ` ` 9KDSKMGROriginBUnit2Data?CodeDSKASTLDIRSHL7BXDSKERRERRXITTSTUNDDSTPTDSKNITBPDAFCNSELDRVDSKMGRGETXDR `1 QS`ˉ``` ڊ:uBCB['KYyB\U D] t6T DD DOt.<u(\UD]T&ӋT l <s<sDOÈDDD,r u u ;ËL$IDxAL\$\TDdx\ǀuKuڹ A)syIAx )sڋ\ˋL D"D L \TڋLˇڋ \)s,Sˉ\ Q ZuH\ LډӉ\ 7 \C뻊D\T0)s؎ otD  ttDx\ÊD$¶` Ӌu%S *uD t ; Routine to reset slave & download intermediate loader ; ;&== ; ; DISKS ; ;&== ; ; DISKS ; ; LFT supports three standard configurations ; ; A. Floppies ; B. DMA winchesters (1100 controller). ; C. RAM disk ; ; Choose one of the sets below acco LjLSAFPDAFCBPCKFCBW`CKOPNDFNDFFPFNDNFPCKOPNFCMPFFOLKRFCNFNDLOKCKLCOM MAKLOKACKWSLKpCKWRLK FRELEPFRRFCNbGETTFLiGETTFF&ia,h ( $t<t<t t  t4¶`ӊ ? }t 3C "u q uC 'û 9 u_\uSCC WD] BBBBӈC7CC7CCCڈC7CC7Z\xDwDwuTx` 0 u ÃSLIDnt& t0[Cڋ\U&CyDi ڈC g\uS t V@u  P[\u ='@ ;PR ,' -uZX D]\U t  t @& 't u  u  C''Ë\uS` t7  u*\uS  Zt- t R  Z` ŋ` t  [\uû  \uS` &` C&'CC&` tT\u Ӡ`:s`ڋ\u` ӜC'CCLs` u` Cڋ\U ˋD] C[\u` ttu  t\u@ Du&' {t >t,& ht +u&'߰ uu&&oQ YË\u ?ڕ1&8u&G(tQS [Yu&&ot 0ËTu\UCD]ÊDwt \x\u  t  O PteDe tadalauDaDeX ? Tu\x9ӉuTxLwZ\uDnPCDntU\Ut]\L]ZD]DUXDn u6 kCu-uS t RC@u [u@\uÊDwt` \x\uQ Yt 0$`\u ]t ӊ(u` `\u ڻ`09t U u\uË\uS  [\uð ``\u t )u ڋ\x9uDwt tuڻ`09BBRdnt & t0[8uOCTU&yDi:u4`BC t& tPt@&$Q$8Yu0Ç&$ u< AQ u+ c t u :u Yt, %DOÈDOY (tQ MYû  u+Sڻ` ، GGG Z0C&CP&CP&PS [X&KX&KX& u u u @u Ë\uS t u  @t [\u yt F u. AQ YuQ 8 u  Yt DOÈDOS SL[u[ zt2C` 0&'C؇ڈCڈڈ` G û` G ` G  u' u trt u C&C&"C&" t:SQڻ` Vts` +s"t ` @u`` 1 rtY[Y[ I뼽` 1ڊCCFEĝý` 1ڊCCFEĝ ً09Ë\u+ C<,Ë\u\uË\u5  Ë\uË\u/FFOMGROriginBUnitLDataCodeALLOCFFPCOMLDIRLNKENDCKDROCKFRO CKFCBW GETS1A DELFIL OPNEXT MAKEXTLOKFILWRRECCFREFILFLOADCBUFMGRGETRCAUNLINKDEALOCCKOPNFWAITRDRANDRESCURGETBLMGETCRAGETBLKGETFXAGETMMBUPDAFP SAVFCB!RESBIT"SIGNAL#WRRAND$CLSEXT%RDRECC&CMPLEN'CMPFFOGETF1AOPNFFOCLSFFOwDRFFO1}DRFFOL_2RDFIFOWRFIFOGETF1Ca tu btn ui -u_S R\+ D-  7  -  #[uCC'CCCC Z`0ÉډW t$ t t u u u  u u u t Rs \UD]t u}LnQ & tDn  YLnu\ tU uNuAL/D&ZR dӎL * v&CD& &KK&ZRZ t t) t tCRQS [YZ t  u  uDO u R  t  \jS ؋ll[ AS  Ӌ9[s  Zt RZR au G G  &&"uC& tLuRS &CC& [Zt$ t&K&Ru & Z!Z ! ӊt R" ZZDO MtMYrdingly. ; ; NOTE: The order of the driver modules determines the name of the ; =driver entry point. For example, if you have Floppies and ; `u.` `` u؎ڱ3 .` U.` .` 0 \,`` :@u tVtXtNtP<t,tBt``t b`R 5[CuC`  ` ` u ``'< u `/< u CCMCD`5t`3 `,`2`& t `F`&; @u ` ` `J   $ ?t *t`J  /t t`Z `o` % rڈCځ`r  sSC`r[K`n`n ػ`J.` \  `&x``5t N`3 K`` s  `N`&u#`t` u±>`u  0DS \UD]&&_S Z` SDU &< uCڻ`S P[  NrCtu) r8t"<.tE<:tI`  r!t4u ru)< u r tJ ZS` ،[[ \Oð(t`C<0r<:s<,0Ġ`%t`%Q`#rrrrr< s `#Yt$Yu4 G uϰ' & &'9t M:t& YLn   P xXt\\L0 0à :ruKK :ru CCC :rÊ KK CCC  &&CC&7Lj$$ňŜ $ C&C&/C&;< rBR=>rFu?uZTU\\QDDSDDO<DDQDDUDDSDDOÊDU@A` DVt'RSDUB[ZNeuLVu !Ӊ`ÈDO Ӊ`ðtȈSDUDDCtD[É\Q<ErFrGHDO<G `t;`sx`ruWuWt]`\G`Z`Z 5tS[t `\WuW9s S `ZG`\ H= uʉW[ ^>`t E`3u`/`*`,`0`2`-`3Dj`*a` t7O-S po>au ؋` Q ` EY[ Ìػ`*.`3 0`3; :`* Gt Q`Z W@u¹ `\S [Y DO= O Uta>`1rZ`'tS`'`)`!u? u: `*t.SP WX G[GS_&[`DlDjQrVtjtl PDj llQ XUHP$ X@Q 3 Ƅ @DlY]X DlDjU a*]Y ú` $`*`^`Z9FLUSHROriginBUnitDataCodeCRPROCOTNTRYCALCBVDSKASTDSTPTBFLDLYBFLNIT ,! OO`t``  _tR``t ` `Zyۋ```1!Ӻ S &[tR0s S[Zy` `ӊ$DPFCN?AMFCN@DMFCNOASMFCNBRMFCNCSESFCNDSERFCNESDTFCNFRDTFCNGRDMFCNHROUFCNISCFFCNJLOGFCNKLFFCNLADFFCNMALDFCNNSCLFCNORAVFCNPRDPFCNQSRSFCNRPDAFCNSSBPFCNTRBPFCNULFDFCNVFFBFCNWSRPFCNXEOPFCNYSRDFCNZQPFFCN[FLBFCN\RCFCN]CCSFCN^CCIFCN_CCOFCN`SCBFCNaRCBFCNbSMCFCNcRMCFCNdEXTFCNeRDDFCNfTOFFCNgTMFFCNhTLRFCNiTFRFCNjSFLFCNkRFLFCN;OHlCodemDISDSPnSETDR1oCKATTNpENADSPqGETSDSrGETWSBsNETREQtPFNFCNuDT3FCNvMPMFCNwTSTUNDlOCNTRY lOTNTRY#lXCNTRY0lXTNTRYlERRXIT``````` ` ` ` ` ```````````````` ``` `!`"`#`$`%`&`!#` '`(`)` *`+`",`-`.`/`0`1`2`3`4`5`6` 7`8` O9`:`;`<`=`>`?`@`A`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[` \`]`^`_```a`b`c`d`e` f`g`h`i`j`k`l    damno u    tOtQtStUtWtYt[t]t_ i <D_D]D[DYDWDUDSDQDO t ËdaDO DetPpD_t]l[|YtWTULS\QDO t^qO&VrƉ\QLSTUDW|Yl[D]D_DO srKDS u`<2%GETAVL?GETNAB@GETXDRACALCBVBCKOPNDCCKDRVLDDSKMGRECKDROFGETLSAOAGZERODNHALVNITIADVDNOJCLSFPKCRFCBPLGETDLSMFNDNDENFNDDDEROVECTOFFCN OPNFILCFFCNCLSFIL SFFFCNSNFFCNDFFCNDELFILCRSFFCNWSFFCNMFFCNMAKFILRFFCN CQMCOMSFAFCNHCKLEXTcRDRANDhRRFFCNWRRANDWRFFCNCKLERRCFSFCNCFSFILSRRFCNKLFFCNNRAVFCNRDPFCNSRSFCN RDMFCN& RDDFCN  DOÈ u|O t# PtKufu:\UD]&G t- u# &u u4 G &0Ê $<t tDnt& u P uXDOuL &@tCS [&&o&guŀt"QYt DnP tDn  XDn0ËDUDz -t yËDzDUD|DoD~Dq uDOS\UD]&$